anti-Rat (Rattus) Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase anticorps pour Immunocytochemistry

Recommended Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase Antibody

Antigène
Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1) Anticorps
  • PIMT
  • C79501
  • PCM
  • PCMT
  • etID309741.20
  • fj13d06
  • pimt
  • wu:fj13d06
  • protein-L-isoaspartate (D-aspartate) O-methyltransferase
  • protein-L-isoaspartate (D-aspartate) O-methyltransferase 1
  • protein-L-isoaspartate (D-aspartate) O-methyltransferase L homeolog
  • protein-L-isoaspartate(D-aspartate)O-methyltransferase
  • PCMT1
  • Pcmt1
  • pcmt1.L
  • pcmt1
  • pcmt
Reactivité
Humain, Souris, Rat (Rattus)
78
38
29
2
2
2
2
1
1
1
1
1
1
1
1
1
Hôte
Lapin
72
7
Clonalité
Polyclonal
Conjugué
Inconjugué
4
3
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
49
20
15
15
13
8
7
6
4
4
2
2
1
1
Options

Images

N° du produit ABIN4344090
Produit non disponible pour cette région.

General

Antigène Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1) Anticorps
Reactivité Humain, Souris, Rat (Rattus)
(78), (38), (29), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Hôte Lapin
(72), (7)
Clonalité
Polyclonal
Conjugué Inconjugué
(4), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(49), (20), (15), (15), (13), (8), (7), (6), (4), (4), (2), (2), (1), (1)
Pubmed 1 référence disponible
Fournisseur

Détail du produit

Détail du antigène Information d'application Stockage Référence Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWS
Isotype IgG

Détail du antigène

Détail du produit Information d'application Stockage Référence Images Haut de la page
Antigène
Autre désignation PCMT1 (PCMT1 Antibody Extrait)
Sujet Gene Symbol: PCMT1
ID gène 5110
Pathways Ribonucleoprotein Complex Subunit Organization

Information d'application

Détail du produit Détail du antigène Stockage Référence Images Haut de la page
Indications d'application Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit Détail du antigène Information d'application Référence Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Référence

Détail du produit Détail du antigène Information d'application Stockage Images Haut de la page
Produit citée dans:

Forsström, Axnäs, Stengele, Bühler, Albert, Richmond, Hu, Nilsson, Hudson, Rockberg, Uhlen: "Proteome-wide epitope mapping of antibodies using ultra-dense peptide arrays." dans: Molecular & cellular proteomics : MCP, Vol. 13, Issue 6, pp. 1585-97, 2014

Images

Détail du produit Détail du antigène Information d'application Stockage Référence Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1) antibody (ABIN4344090) Immunocytochemistry/Immunofluorescence: PCMT1 Antibody [NBP1-85806] - Staining of hum...
Western Blotting (WB) image for anti-Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1) antibody (ABIN4344090) Western Blot: PCMT1 Antibody [NBP1-85806] - Lane 1: Marker [kDa] 250, 130, 100, 70, 5...
Immunofluorescence (IF) image for anti-Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1) antibody (ABIN4344090) Immunocytochemistry/Immunofluorescence: PCMT1 Antibody [NBP1-85806] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1) antibody (ABIN4344090) Immunohistochemistry-Paraffin: PCMT1 Antibody [NBP1-85806] - Staining of human stomac...
Western Blotting (WB) image for anti-Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1) antibody (ABIN4344090) Western Blot: PCMT1 Antibody [NBP1-85806] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32...
Western Blotting (WB) image for anti-Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1) antibody (ABIN4344090) Western Blot: PCMT1 Antibody [NBP1-85806] - Lane 1: Marker [kDa] 250, 130, 100, 70, 5...
Western Blotting (WB) image for anti-Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1) antibody (ABIN4344090) Western Blot: PCMT1 Antibody [NBP1-85806] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Immunofluorescence (fixed cells) (IF/ICC) image for anti-Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1) antibody (ABIN4344090) Immunocytochemistry/Immunofluorescence: PCMT1 Antibody - Immunofluorescent staining ...
Western Blotting (WB) image for anti-Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1) antibody (ABIN4344090) Western Blot: PCMT1 Antibody - Analysis in MCF-7 cells transfected with control siRN...
Western Blotting (WB) image for anti-Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1) antibody (ABIN4344090) Western Blot: PCMT1 Antibody - Analysis in mouse cell line NIH-3T3, rat cell line NB...