anti-Humain NFKBIZ anticorps pour Immunohistochemistry

Recommended NFKBIZ Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor, zeta (NFKBIZ) Anticorps
  • RGD1310834
  • NFKBIZ
  • MAIL
  • AA408868
  • INAP
  • Mail
  • IKBZ
  • NFKB inhibitor zeta
  • nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta
  • nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, zeta
  • Nfkbiz
  • NFKBIZ
  • nfkbiz
Reactivité
Humain
26
20
8
3
3
3
3
2
2
2
2
2
2
1
Hôte
Lapin
32
4
Clonalité
Polyclonal
Conjugué
Cet anticorp NFKBIZ est non-conjugé
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
34
6
4
3
3
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4324156
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
8.404079 ABIN6263630 IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1859325 ICC IHC WB Rabbit IgG AA 422-651 Connectez-vous pour afficher Polyclonal 0

General

Antigène Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor, zeta (NFKBIZ) Anticorps
Reactivité Humain
(26), (20), (8), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1)
Hôte Lapin
(32), (4)
Clonalité
Polyclonal
Conjugué Cet anticorp NFKBIZ est non-conjugé
(2), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(34), (6), (4), (3), (3), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-NFKBIZ anticorps

Détail du antigène NFKBIZ Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:QGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLL
Isotype IgG
Plasmids, Primers & others

Détail du antigène NFKBIZ

Détail du produit anti-NFKBIZ anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation IKB zeta (NFKBIZ Antibody Extrait)
Sujet Gene Symbol: NFKBIZ
ID gène 64332
UniProt Q9BYH8
Pathways Signalisation NF-kappaB

Information d'application

Détail du produit anti-NFKBIZ anticorps Détail du antigène NFKBIZ Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunohistochemistry-Paraffin 1:10 - 1:20Immunohistochemistry retrieval recommended: HIER pH 6
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-NFKBIZ anticorps Détail du antigène NFKBIZ Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-NFKBIZ anticorps Détail du antigène NFKBIZ Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor, zeta (NFKBIZ) antibody (ABIN4324156) Immunohistochemistry-Paraffin: IKB zeta Antibody [NBP1-89835] - Staining of human bon...
Immunohistochemistry (IHC) image for anti-Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor, zeta (NFKBIZ) antibody (ABIN4324156) Immunohistochemistry: IKB zeta Antibody [NBP1-89835] - Immunohistochemical staining o...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor, zeta (NFKBIZ) antibody (ABIN4324156) Immunohistochemistry-Paraffin: IKB zeta Antibody - Staining of human bone marrow sho...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor, zeta (NFKBIZ) antibody (ABIN4324156) Immunohistochemistry-Paraffin: IKB zeta Antibody - Staining of human cerebral cortex...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor, zeta (NFKBIZ) antibody (ABIN4324156) Immunohistochemistry-Paraffin: IKB zeta Antibody - Staining in human bone marrow and...