anti-Humain SLC39A3 anticorps pour Immunofluorescence

Recommended SLC39A3 Antibody

Solute Carrier Family 39 (Zinc Transporter), Member 3 (SLC39A3) Anticorps
  • AI845814
  • Zip3
  • ZIP3
  • wu:fc84e09
  • zgc:158334
  • solute carrier family 39 (zinc transporter), member 3
  • solute carrier family 39 member 3
  • Slc39a3
  • slc39a3
  • SLC39A3
Cet anticorp SLC39A3 est non-conjugé
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)


N° du produit ABIN4354367
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
1 ABIN2392340 IF IHC ELISA WB Rabbit IgG Polyclonal 0


Antigène Solute Carrier Family 39 (Zinc Transporter), Member 3 (SLC39A3) Anticorps
Reactivité Humain
(33), (20), (4)
Hôte Lapin
(33), (1)
Conjugué Cet anticorp SLC39A3 est non-conjugé
(2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(23), (20), (19), (5), (3), (1)

Détail du produit anti-SLC39A3 anticorps

Détail du antigène SLC39A3 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:TFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGL
Isotype IgG
Plasmids, Primers & others

Détail du antigène SLC39A3

Détail du produit anti-SLC39A3 anticorps Information d'application Stockage Images Haut de la page
Autre désignation SLC39A3 (SLC39A3 Antibody Extrait)
Sujet Gene Symbol: SLC39A3
ID gène 29985
Pathways Signalisation NF-kappaB, Neurotrophin Signaling Pathway, Autophagy

Information d'application

Détail du produit anti-SLC39A3 anticorps Détail du antigène SLC39A3 Stockage Images Haut de la page
Indications d'application Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Détail du produit anti-SLC39A3 anticorps Détail du antigène SLC39A3 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Détail du produit anti-SLC39A3 anticorps Détail du antigène SLC39A3 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Solute Carrier Family 39 (Zinc Transporter), Member 3 (SLC39A3) antibody (ABIN4354367) Immunohistochemistry-Paraffin: SLC39A3 Antibody [NBP1-86829] - Staining of human colo...
Western Blotting (WB) image for anti-Solute Carrier Family 39 (Zinc Transporter), Member 3 (SLC39A3) antibody (ABIN4354367) Western Blot: SLC39A3 Antibody [NBP1-86829] - Lane 1: Marker [kDa] 250, 130, 95, 72, ...
Immunofluorescence (IF) image for anti-Solute Carrier Family 39 (Zinc Transporter), Member 3 (SLC39A3) antibody (ABIN4354367) Immunocytochemistry/Immunofluorescence: SLC39A3 Antibody [NBP1-86829] - Immunofluores...
Immunofluorescence (IF) image for anti-Solute Carrier Family 39 (Zinc Transporter), Member 3 (SLC39A3) antibody (ABIN4354367) Immunocytochemistry/Immunofluorescence: SLC39A3 Antibody - Staining of human cell li...
Western Blotting (WB) image for anti-Solute Carrier Family 39 (Zinc Transporter), Member 3 (SLC39A3) antibody (ABIN4354367) Western Blot: SLC39A3 Antibody - Analysis in control (vector only transfected HEK293...