anti-Humain DTX2 anticorps pour Immunocytochemistry

Recommended DTX2 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Deltex Homolog 2 (Drosophila) (DTX2) Anticorps
  • RNF58
  • 2610524D08Rik
  • AA408415
  • AU022494
  • Deltex2
  • dtx2
  • deltex E3 ubiquitin ligase 2
  • probable E3 ubiquitin-protein ligase DTX2
  • deltex 2, E3 ubiquitin ligase
  • deltex 2, E3 ubiquitin ligase S homeolog
  • DTX2
  • Dtx2
  • LOC735784
  • LOC747633
  • dtx2
  • dtx2.S
Reactivité
Humain
59
29
28
4
4
3
2
2
2
2
1
1
Hôte
Lapin
40
15
4
Clonalité
Polyclonal
Conjugué
Cet anticorp DTX2 est non-conjugé
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
26
24
20
13
5
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4306356
Produit non disponible pour cette région.

General

Antigène Deltex Homolog 2 (Drosophila) (DTX2) Anticorps
Reactivité Humain
(59), (29), (28), (4), (4), (3), (2), (2), (2), (2), (1), (1)
Hôte Lapin
(40), (15), (4)
Clonalité
Polyclonal
Conjugué Cet anticorp DTX2 est non-conjugé
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(26), (24), (20), (13), (5)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-DTX2 anticorps

Détail du antigène DTX2 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids: YPVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQH PPHRTASVFGTHQAFAPYNKPSL
Isotype IgG
Plasmids, Primers & others

Détail du antigène DTX2

Détail du produit anti-DTX2 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation DTX2 (DTX2 Antibody Extrait)
Sujet Gene Symbol: DTX2
ID gène 113878
Pathways Signalisation Notch

Information d'application

Détail du produit anti-DTX2 anticorps Détail du antigène DTX2 Stockage Images Haut de la page
Indications d'application Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-DTX2 anticorps Détail du antigène DTX2 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-DTX2 anticorps Détail du antigène DTX2 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Deltex Homolog 2 (Drosophila) (DTX2) antibody (ABIN4306356) Immunohistochemistry-Paraffin: DTX2 Antibody [NBP2-13941] - Staining of human cerebel...
Immunofluorescence (IF) image for anti-Deltex Homolog 2 (Drosophila) (DTX2) antibody (ABIN4306356) Immunocytochemistry/Immunofluorescence: DTX2 Antibody [NBP2-13941] - Staining of huma...
Western Blotting (WB) image for anti-Deltex Homolog 2 (Drosophila) (DTX2) antibody (ABIN4306356) Western Blot: DTX2 Antibody [NBP2-13941] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Deltex Homolog 2 (Drosophila) (DTX2) antibody (ABIN4306356) Immunohistochemistry-Paraffin: DTX2 Antibody - Staining of human esophagus shows cyt...