anti-Humain PDK2 anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended PDK2 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) Anticorps
  • 3j828
  • MGC52849
  • MGC132353
  • Pdk
  • zgc:56209
  • PDK2
  • PDHK2
  • PDKII
  • pyruvate dehydrogenase kinase 4 L homeolog
  • pyruvate dehydrogenase kinase, isozyme 2b
  • pyruvate dehydrogenase kinase 2
  • pyruvate dehydrogenase kinase, isoenzyme 2
  • pdk4.L
  • pdk2b
  • PDK2
  • Pdk2
Reactivité
Humain, Souris
141
89
54
12
5
2
2
2
1
1
1
1
1
1
Hôte
Lapin
117
41
Clonalité
Polyclonal
Conjugué
Cet anticorp PDK2 est non-conjugé
9
9
8
7
7
7
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
145
93
82
33
24
13
4
3
3
1
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4344598
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
12.982011 ABIN4890304 IHC IHC (p) WB Rabbit Connectez-vous pour afficher Polyclonal 0
12.982011 ABIN4912898 IHC (p) WB Mouse IgG1 kappa Connectez-vous pour afficher 180CT10-2-3 0
1 ABIN391037 IHC (p) WB Rabbit Ig Fraction AA 378-407, C-Term Connectez-vous pour afficher Polyclonal 9
1 ABIN657996 IHC (p) WB Rabbit Ig Fraction AA 78-107, N-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN768724 IHC IHC (p) WB Rabbit IgG AA 251-300 Connectez-vous pour afficher Polyclonal 0
1 ABIN562160 IHC (p) RNAi ELISA WB Mouse IgG2a kappa AA 187-276, partial Connectez-vous pour afficher 2G1 4
1 ABIN653784 FACS IHC (p) WB Rabbit Ig Fraction Connectez-vous pour afficher Polyclonal 2
1 ABIN3044044 ICC IHC (p) WB Rabbit IgG AA 379-392, C-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN626053 ELISA IHC IHC (p) WB Mouse IgG2a, kappa AA 187-276 Connectez-vous pour afficher 2G1 0
1 ABIN626054 ELISA IHC IHC (p) WB Mouse IgG2a, kappa AA 187-276 Connectez-vous pour afficher 5F8 0
1 ABIN5556304 FACS IHC (p) WB Rabbit Ig Fraction Connectez-vous pour afficher Polyclonal 0
1 ABIN5537295 IHC (p) WB Rabbit Ig Fraction AA 378-407, C-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN518756 IHC (p) ELISA WB Mouse IgG2a kappa AA 187-276, partial Connectez-vous pour afficher 5F8 0
1 ABIN5537294 IHC (p) WB Rabbit Ig Fraction AA 78-107, N-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN5537296 FACS IHC (p) WB Rabbit Ig Fraction Connectez-vous pour afficher Polyclonal 0
1 ABIN2626695 ICC IHC IHC (p) WB Rabbit IgG AA 379-392 Connectez-vous pour afficher Polyclonal 0
1 ABIN781865 EIA IHC (p) WB Mouse IgG2a Connectez-vous pour afficher 2G1 0
1 ABIN781866 EIA IHC (p) WB Mouse IgG2a Connectez-vous pour afficher 5F8 0
1 ABIN5552188 EIA IHC (p) WB Rabbit Ig Fraction C-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN751792 IHC (p) WB HRP Rabbit IgG Connectez-vous pour afficher Polyclonal 0

General

Antigène Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) Anticorps
Reactivité Humain, Souris
(141), (89), (54), (12), (5), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Hôte Lapin
(117), (41)
Clonalité
Polyclonal
Conjugué Cet anticorp PDK2 est non-conjugé
(9), (9), (8), (7), (7), (7), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(145), (93), (82), (33), (24), (13), (4), (3), (3), (1), (1), (1)
Pubmed 1 référence disponible
Fournisseur Connectez-vous pour afficher

Détail du produit anti-PDK2 anticorps

Détail du antigène PDK2 Information d'application Stockage References for anti-PDK2 antibody (ABIN4344598) Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:KTSFTFLRQELPVRLANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGSTN
Isotype IgG
Plasmids, Primers & others

Détail du antigène PDK2

Détail du produit anti-PDK2 anticorps Information d'application Stockage References for anti-PDK2 antibody (ABIN4344598) Images Haut de la page
Antigène
Autre désignation PDK2 (PDK2 Antibody Extrait)
Sujet Gene Symbol: PDK2
ID gène 5164
Pathways Signalisation PI3K-Akt, Signalisation RTK, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process

Information d'application

Détail du produit anti-PDK2 anticorps Détail du antigène PDK2 Stockage References for anti-PDK2 antibody (ABIN4344598) Images Haut de la page
Indications d'application Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-PDK2 anticorps Détail du antigène PDK2 Information d'application References for anti-PDK2 antibody (ABIN4344598) Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PDK2 antibody (ABIN4344598)

Détail du produit anti-PDK2 anticorps Détail du antigène PDK2 Information d'application Stockage Images Haut de la page
Produit citée dans:

Hou, Zhang, Han, Ge, Ma, Zhang, Moley, Schedl, Wang: "Differing roles of pyruvate dehydrogenase kinases during mouse oocyte maturation." dans: Journal of cell science, Vol. 128, Issue 13, pp. 2319-29, 2015 (Échantillon (espèces): Mouse (Murine)). Détails: Immunocytochemistry,Immunofluorescence

Images

Détail du produit anti-PDK2 anticorps Détail du antigène PDK2 Information d'application Stockage References for anti-PDK2 antibody (ABIN4344598) Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) antibody (ABIN4344598) Immunocytochemistry/Immunofluorescence: PDK2 Antibody [NBP1-87307] - Staining of huma...
Immunofluorescence (IF) image for anti-Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) antibody (ABIN4344598) Immunocytochemistry/Immunofluorescence: PDK2 Antibody [NBP1-87307] - Staining of huma...
Western Blotting (WB) image for anti-Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) antibody (ABIN4344598) Western Blot: PDK2 Antibody [NBP1-87307] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) antibody (ABIN4344598) Immunohistochemistry-Paraffin: PDK2 Antibody [NBP1-87307] - Staining of human heart m...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) antibody (ABIN4344598) Immunohistochemistry-Paraffin: PDK2 Antibody [NBP1-87307] - Staining of human pancrea...
Immunofluorescence (IF) image for anti-Pyruvate Dehydrogenase Kinase, Isozyme 2 (PDK2) antibody (ABIN4344598) Immunocytochemistry/Immunofluorescence: PDK2 Antibody - Immunofluorescent staining o...