anti-Humain BRK1 anticorps pour Western Blotting

Recommended BRK1 Antibody

Antigène
BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) Anticorps
  • brk1
  • C22H3orf10
  • brick1
  • c3orf10
  • C3orf10
  • MDS027
  • hHBrk1
  • 6720456B07Rik
  • AW011779
  • ATBRK1
  • BRICK1
  • HSPC300
  • T9I22.8
  • T9I22_8
  • BRICK1, SCAR/WAVE actin-nucleating complex subunit
  • BRICK1, SCAR/WAVE actin nucleating complex subunit
  • brick 1
  • BRICK1, SCAR/WAVE actin-nucleating complex subunit S homeolog
  • BRICK1
  • brk1
  • BRK1
  • Brk1
  • brk1.S
Épitope
Middle Region
1
1
Reactivité
Humain, Souris, Rat (Rattus), Chien, Poisson zèbre (Danio rerio)
36
31
22
3
3
2
2
2
1
1
Hôte
Lapin
32
4
Clonalité
Polyclonal
Conjugué
Cet anticorp BRK1 est non-conjugé
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
13
13
11
9
5
Options

Images

N° du produit ABIN629872
$ 369.29
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
10.857681 ABIN2784463 IHC WB Rabbit Middle Region Polyclonal 0
10.857681 ABIN2434746 IHC ELISA WB Rabbit IgG Polyclonal 0
7.8576813 ABIN5573368 IHC (p) WB Rabbit Polyclonal 0
7 ABIN341474 IHC IHC (p) WB Rabbit IgG C-Term Polyclonal 0
4.8576813 ABIN5573366 ELISA WB Mouse IgG2b 1c055 0
4.8576813 ABIN2463416 IHC ELISA WB Rabbit Polyclonal 0
4.8576813 ABIN5573367 ELISA WB Mouse IgG2b 37 0
1 ABIN710045 IHC (p) WB HRP Rabbit IgG Polyclonal 0
1 ABIN710038 IHC (p) WB Biotin Rabbit IgG Polyclonal 0
1 ABIN710036 IF (p) IHC (p) WB Rabbit IgG Polyclonal 0
1 ABIN6041476 ELISA IHC WB Rabbit IgG Polyclonal 0
1 ABIN2688375 ELISA WB Mouse IgG2b 0
1 ABIN1854255 ELISA WB Mouse IgG2b 0

General

Antigène BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) Anticorps
Épitope Middle Region
(1), (1)
Reactivité Humain, Souris, Rat (Rattus), Chien, Poisson zèbre (Danio rerio)
(36), (31), (22), (3), (3), (2), (2), (2), (1), (1)
Hôte Lapin
(32), (4)
Clonalité
Polyclonal
Conjugué Cet anticorp BRK1 est non-conjugé
(2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(13), (13), (11), (9), (5)
Fournisseur

Détail du produit anti-BRK1 anticorps

Détail du antigène BRK1 Information d'application Stockage Images
Specificité C3 ORF10 antibody was raised against the middle region of C3 rf10
Purification Purified
Immunogène C3 ORF10 antibody was raised using the middle region of C3 rf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
Plasmids, Primers & others

Détail du antigène BRK1

Détail du produit anti-BRK1 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation C3ORF10 (BRK1 Antibody Extrait)
Sujet C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.
Poids moléculaire 9 kDa (MW of target protein)
Pathways Signalisation RTK

Information d'application

Détail du produit anti-BRK1 anticorps Détail du antigène BRK1 Stockage Images Haut de la page
Indications d'application WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Commentaires

C3ORF10 Blocking Peptide, catalog no. 33R-10134, is also available for use as a blocking control in assays to test for specificity of this C3ORF10 antibody

Restrictions For Research Use only

Stockage

Détail du produit anti-BRK1 anticorps Détail du antigène BRK1 Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF10 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Détail du produit anti-BRK1 anticorps Détail du antigène BRK1 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (IHC) image for anti-BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) (Middle Region) antibody (ABIN629872) C3ORF10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to...
Immunohistochemistry (IHC) image for anti-BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) (Middle Region) antibody (ABIN629872) C3ORF10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. M...
Western Blotting (WB) image for anti-BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1) (Middle Region) antibody (ABIN629872) C3ORF10 antibody used at 2.5 ug/ml to detect target protein.