anti-Humain Ephrin A5 anticorps pour Immunocytochemistry

Recommended Ephrin A5 Antibody (fourni par: Connectez-vous pour afficher )

Ephrin A5 (EFNA5) Anticorps
  • EFNA5
  • af1
  • efl5
  • rags
  • eplg7
  • lerk7
  • AL-1
  • AV158822
  • EFL-5
  • Ephrin-A5
  • Epl7
  • LERK-7
  • RAGS
  • Lerk7
  • AF1
  • EFL5
  • EPLG7
  • GLC1M
  • LERK7
  • ephrin A5
  • EFNA5
  • efna5
  • Efna5
Cet anticorp Ephrin A5 est non-conjugé
Immunocytochemistry (ICC), Immunofluorescence (IF)
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus


N° du produit ABIN5076560
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN1867697 ICC IHC IP WB Rabbit IgG AA 21-203 Connectez-vous pour afficher Polyclonal
1 ABIN2740477 FACS ICC IF IHC (p) WB Rabbit Internal Region Connectez-vous pour afficher Polyclonal
1 ABIN2857564 ICC IF IHC WB Rabbit Connectez-vous pour afficher Polyclonal


Antigène Ephrin A5 (EFNA5) Anticorps
Reactivité Humain
(61), (47), (42), (9), (8), (6), (5), (5), (4), (3), (2), (2), (2), (1), (1)
Hôte Lapin
(56), (9), (5), (1)
Conjugué Cet anticorp Ephrin A5 est non-conjugé
(3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(48), (34), (17), (15), (14), (13), (4), (3), (3), (3), (1)
Pubmed 1 référence disponible
Fournisseur Connectez-vous pour afficher

Détail du produit anti-Ephrin A5 anticorps

Détail du antigène Ephrin A5 Information d'application Stockage References for anti-Ephrin A5 antibody (ABIN5076560) Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogène This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQ
Isotype IgG

Détail du antigène Ephrin A5

Détail du produit anti-Ephrin A5 anticorps Information d'application Stockage References for anti-Ephrin A5 antibody (ABIN5076560) Images Haut de la page
Autre désignation Ephrin-A5 (EFNA5 Antibody Extrait)
Sujet Gene Symbol: EFNA5
ID gène 1946
Pathways Signalisation RTK

Information d'application

Détail du produit anti-Ephrin A5 anticorps Détail du antigène Ephrin A5 Stockage References for anti-Ephrin A5 antibody (ABIN5076560) Images Haut de la page
Indications d'application Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Détail du produit anti-Ephrin A5 anticorps Détail du antigène Ephrin A5 Information d'application References for anti-Ephrin A5 antibody (ABIN5076560) Images Haut de la page
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Ephrin A5 antibody (ABIN5076560)

Détail du produit anti-Ephrin A5 anticorps Détail du antigène Ephrin A5 Information d'application Stockage Images Haut de la page
Produit citée dans:

Andretta, Cartón-García, Martínez-Barriocanal, de Marcondes, Jimenez-Flores, Macaya, Bazzocco, Bilic, Rodrigues, Nieto, Landolfi, Ramon Y Cajal, Schwartz, Brown, Dopeso, Arango: "Investigation of the role of tyrosine kinase receptor EPHA3 in colorectal cancer." dans: Scientific reports, Vol. 7, pp. 41576, 2017 Méthode utilisée: Western Blotting (WB) (Échantillon (espèces): Mouse (Murine)).


Détail du produit anti-Ephrin A5 anticorps Détail du antigène Ephrin A5 Information d'application Stockage References for anti-Ephrin A5 antibody (ABIN5076560) Haut de la page
Supplier Images
Immunofluorescence (IF) image for anti-Ephrin A5 (EFNA5) antibody (ABIN5076560) Immunocytochemistry/Immunofluorescence: Ephrin-A5 Antibody - Staining of human cell ...