anti-Humain Ephrin B2 anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended Ephrin B2 Antibody (fourni par: Connectez-vous pour afficher )

Ephrin B2 (EFNB2) Anticorps
  • EFNB2
  • efnb2
  • ephrin-B2
  • htkl
  • eplg5
  • htk-l
  • lerk5
  • ephrinB2
  • efnb2a
  • MGC68890
  • efnb2b
  • ELF-2
  • Epl5
  • Eplg5
  • Htk-L
  • LERK-5
  • Lerk5
  • NLERK-1
  • EPLG5
  • HTKL
  • LERK5
  • ephrin B2
  • ephrin-B2 precursor
  • ephrin B2 L homeolog
  • ephrin B2 S homeolog
  • EFNB2
  • efnb2
  • efnb2.L
  • efnb2.S
  • Efnb2
Cet anticorp Ephrin B2 est non-conjugé
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus


N° du produit ABIN4308730
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
12.519402 ABIN4308731 ICC IF IHC (p) WB Rabbit Connectez-vous pour afficher Polyclonal
1 ABIN655599 IF IHC (p) WB Rabbit Ig Fraction AA 157-186, Center Connectez-vous pour afficher Polyclonal 1
1 ABIN5556234 EIA IF IHC (p) WB Rabbit Ig Fraction AA 164-194, Middle Region Connectez-vous pour afficher Polyclonal
1 ABIN5531138 IF IHC (p) WB Rabbit Ig Fraction AA 157-186 Connectez-vous pour afficher Polyclonal
1 ABIN2962619 IF IHC (p) WB Rabbit AA 157-186 Connectez-vous pour afficher Polyclonal
1 ABIN1978656 IF IHC (p) WB Rabbit AA 157-186 Connectez-vous pour afficher Polyclonal


Antigène Ephrin B2 (EFNB2) Anticorps
Reactivité Humain
(99), (44), (26), (5), (5), (5), (3), (3), (3), (2), (2), (1), (1)
Hôte Lapin
(86), (16), (2)
Conjugué Cet anticorp Ephrin B2 est non-conjugé
(3), (3), (3), (3), (3), (3)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(85), (37), (32), (25), (9), (7), (3), (2), (1), (1), (1)
Pubmed 3 références disponible
Fournisseur Connectez-vous pour afficher

Détail du produit anti-Ephrin B2 anticorps

Détail du antigène Ephrin B2 Information d'application Stockage References for anti-Ephrin B2 antibody (ABIN4308730) Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP
Isotype IgG

Détail du antigène Ephrin B2

Détail du produit anti-Ephrin B2 anticorps Information d'application Stockage References for anti-Ephrin B2 antibody (ABIN4308730) Images Haut de la page
Autre désignation Ephrin B2 (EFNB2 Antibody Extrait)
Sujet Gene Symbol: EFNB2
ID gène 1948
Domaine de recherche Neurology, Angiogenesis
Pathways Signalisation RTK, Regulation of Muscle Cell Differentiation

Information d'application

Détail du produit anti-Ephrin B2 anticorps Détail du antigène Ephrin B2 Stockage References for anti-Ephrin B2 antibody (ABIN4308730) Images Haut de la page
Indications d'application Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Détail du produit anti-Ephrin B2 anticorps Détail du antigène Ephrin B2 Information d'application References for anti-Ephrin B2 antibody (ABIN4308730) Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Ephrin B2 antibody (ABIN4308730)

Détail du produit anti-Ephrin B2 anticorps Détail du antigène Ephrin B2 Information d'application Stockage Images Haut de la page
Produit citée dans:

Nakayama, Nakayama, van Lessen, Yamamoto, Hoffmann, Drexler, Itoh, Hirose, Breier, Vestweber, Cooper, Ohno, Kaibuchi, Adams: "Spatial regulation of VEGF receptor endocytosis in angiogenesis." dans: Nature cell biology, Vol. 15, Issue 3, pp. 249-60, 2013

Nakayama, Nakayama, Turner, Höing, Lepore, Adams: "Ephrin-B2 controls PDGFR? internalization and signaling." dans: Genes & development, Vol. 27, Issue 23, pp. 2576-89, 2013

Dravis, Henkemeyer: "Ephrin-B reverse signaling controls septation events at the embryonic midline through separate tyrosine phosphorylation-independent signaling avenues." dans: Developmental biology, Vol. 355, Issue 1, pp. 138-51, 2011 (Échantillon (espèces): Mouse (Murine)). Détails: Western Blotting


Détail du produit anti-Ephrin B2 anticorps Détail du antigène Ephrin B2 Information d'application Stockage References for anti-Ephrin B2 antibody (ABIN4308730) Haut de la page
Supplier Images
Western Blotting (WB) image for anti-Ephrin B2 (EFNB2) antibody (ABIN4308730) Western Blot: Ephrin B2 Antibody [NBP1-84830] - Lane 1: Marker [kDa] 230, 130, 95, 72...
Western Blotting (WB) image for anti-Ephrin B2 (EFNB2) antibody (ABIN4308730) Western Blot: Ephrin B2 Antibody [NBP1-84830] - Lane 1: NIH-3T3 cell lysate (Mouse em...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ephrin B2 (EFNB2) antibody (ABIN4308730) Immunohistochemistry-Paraffin: Ephrin B2 Antibody [NBP1-84830] - Staining of human he...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Ephrin B2 (EFNB2) antibody (ABIN4308730) Immunohistochemistry-Paraffin: Ephrin B2 Antibody - Staining of human kidney shows m...
Immunofluorescence (IF) image for anti-Ephrin B2 (EFNB2) antibody (ABIN4308730) Immunocytochemistry/Immunofluorescence: Ephrin B2 Antibody - Staining of human cell ...