anti-Humain IL21 anticorps pour ELISA

Recommended IL21 Antibody (fourni par: Connectez-vous pour afficher )

Interleukin 21 (IL21) Anticorps
  • IL-21
  • Za11
  • interleukin 21
  • IL21
  • Il21
AA 71-102
Cet anticorp IL21 est non-conjugé
Immunocytochemistry (ICC), Immunohistochemistry (IHC), ELISA
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus


N° du produit ABIN342791
$ 683.83
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN4324904 ELISA ICC IF WB Rabbit all Isoforms Connectez-vous pour afficher Polyclonal 0
1 ABIN449981 IHC (p) IHC ELISA Goat N-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN2689755 ELISA Biotin Mouse IgG1, kappa Connectez-vous pour afficher I76 2
1 ABIN1452162 ELISA WB Rabbit IgG AA 91-140 Connectez-vous pour afficher Polyclonal 2
1 ABIN2689754 ELISA Mouse IgG1, kappa Connectez-vous pour afficher J148 2
1 ABIN1002621 ICC ELISA WB Rabbit IgG Internal Region Connectez-vous pour afficher Polyclonal 3
1 ABIN3185169 ELISA WB Rabbit IgG Internal Region Connectez-vous pour afficher Polyclonal 0
1 ABIN1819420 ELISA Goat IgG AA 40-68 Connectez-vous pour afficher Polyclonal 0
1 ABIN1819419 ELISA Rabbit IgG AA 125-153 Connectez-vous pour afficher Polyclonal 0
1 ABIN342763 ICC ELISA Rabbit AA 118-146 Connectez-vous pour afficher Polyclonal 0
1 ABIN342764 ICC ELISA Goat AA 33-61 Connectez-vous pour afficher Polyclonal 0
1 ABIN5627170 ELISA ICC IF WB Rabbit IgG all Isoforms Connectez-vous pour afficher Polyclonal 0
1 ABIN1031410 ELISA WB Rabbit N-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN1030836 IHC ELISA WB Rabbit Extracellular Domain Connectez-vous pour afficher Polyclonal 0
1 ABIN1030955 ICC ELISA WB Rabbit Middle Region Connectez-vous pour afficher Polyclonal 0
1 ABIN566195 ELISA WB Mouse AA 63-162, partial Connectez-vous pour afficher Polyclonal 0
1 ABIN2468185 ELISA WB Chicken AA 33-111 Connectez-vous pour afficher Polyclonal 0
1 ABIN2885661 ELISA WB Rabbit IgG AA 91-140 Connectez-vous pour afficher Polyclonal 0
1 ABIN1868629 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2291372 ELISA WB Rabbit IgG C-Term, AA 110-139 Connectez-vous pour afficher Polyclonal 0


Antigène Interleukin 21 (IL21) Anticorps
Épitope AA 71-102
(19), (17), (15), (8), (8), (8), (7), (6), (6), (6), (5), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivité Humain
(212), (108), (29), (9), (4), (4), (4), (1), (1)
Hôte Chèvre
(177), (75), (39), (9), (5)
Conjugué Cet anticorp IL21 est non-conjugé
(24), (14), (12), (12), (10), (9), (6), (5), (5), (5), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunohistochemistry (IHC), ELISA
(201), (137), (51), (48), (32), (24), (15), (13), (10), (7), (6), (6), (5), (4), (4), (3), (2), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-IL21 anticorps

Détail du antigène IL21 Information d'application Stockage Images
Specificité Peptide sequence is <50 % identical to other interleukins in this region. The antibody recognizes human IL-21.
Homologie Percent identity by BLAST analysis: Human, Gorilla (100%) Gibbon, Marmoset (97%) Monkey (94%).
Purification Immunoaffinity purified
Immunogène Synthetic peptide 78CFQKAQLKSANTGNNERIINVSIKKLKRKPPS109 corresponding to N-terminus region of human IL-21. Percent identity by BLAST analysis: Human, Gorilla (100%), Gibbon, Marmoset (97%), Monkey (94%).

Type of Immunogen: Synthetic peptide
Plasmids, Primers & others

Détail du antigène IL21

Détail du produit anti-IL21 anticorps Information d'application Stockage Images Haut de la page
Autre désignation IL21 (IL21 Antibody Extrait)
Sujet Name/Gene ID: IL21
Family: Interleukin

Synonyms: IL21, Interleukin 21, Interleukin-21, Interleukin-21 isoform, Za11, IL-21
ID gène 59067
UniProt Q9GZX6
Pathways Signalistation JAK/STAT, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response

Information d'application

Détail du produit anti-IL21 anticorps Détail du antigène IL21 Stockage Images Haut de la page
Indications d'application Approved: ELISA (1:100000), ICC, IHC

Target Species of Antibody: Human

Restrictions For Research Use only


Détail du produit anti-IL21 anticorps Détail du antigène IL21 Information d'application Images Haut de la page
Format Liquid
Concentration Lot specific
Buffer Phosphate buffered saline, 0.1 % sodium azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Conseil sur la manipulation Avoid freeze-thaw cycles.
Stock -20 °C,-80 °C
Stockage commentaire Short term: -20°C
Long term: -70°C
Avoid freeze-thaw cycles.


Détail du produit anti-IL21 anticorps Détail du antigène IL21 Information d'application Stockage Haut de la page
Images (Fournisseur)
 image for anti-Interleukin 21 (IL21) (AA 71-102) antibody (ABIN342791) anti-Interleukin 21 (IL21) (AA 71-102) antibody