anti-Souris IL21 anticorps pour ELISA

Recommended IL21 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Interleukin 21 (IL21) Anticorps
  • IL-21
  • Za11
  • interleukin 21
  • IL21
  • Il21
Épitope
AA 33-61
19
17
15
8
8
8
7
6
6
6
5
3
3
3
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
Reactivité
Souris
213
107
29
9
4
4
4
1
1
Hôte
Chèvre
177
75
39
9
5
Clonalité
Polyclonal
Conjugué
Cet anticorp IL21 est non-conjugé
24
14
12
12
10
9
6
5
5
5
4
3
3
3
3
3
3
3
3
3
3
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), ELISA
201
137
51
48
33
24
15
13
10
7
6
6
5
4
4
3
2
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN342766
$ 683.83
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN152155 ELISA IHC Goat N-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN1452162 ELISA WB Rabbit IgG AA 91-140 Connectez-vous pour afficher Polyclonal 2
1 ABIN2692448 ELISA WB Rabbit IgG AA 25-146 Connectez-vous pour afficher Polyclonal 0
1 ABIN3185169 ELISA WB Rabbit IgG Internal Region Connectez-vous pour afficher Polyclonal 0
1 ABIN465670 ELISA WB Rabbit Connectez-vous pour afficher Polyclonal 0
1 ABIN342765 IHC ELISA Rabbit AA 118-146 Connectez-vous pour afficher Polyclonal 0
1 ABIN1822036 ELISA WB Biotin Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1031410 ELISA WB Rabbit N-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN1030836 IHC ELISA WB Rabbit Extracellular Domain Connectez-vous pour afficher Polyclonal 0
1 ABIN2885661 ELISA WB Rabbit IgG AA 91-140 Connectez-vous pour afficher Polyclonal 0
1 ABIN465338 ELISA WB Biotin Rabbit Connectez-vous pour afficher Polyclonal 0
1 ABIN1819298 ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2214199 ELISA Rabbit IgG AA 25-146 Connectez-vous pour afficher Polyclonal 0
1 ABIN5956941 ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2288622 IC ELISA Rabbit IgG C-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN2288620 IC ELISA Goat IgG N-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN2288639 ELISA WB Chicken IgY AA 18-146 Connectez-vous pour afficher Polyclonal 0
1 ABIN6101576 ELISA WB Rabbit IgG Internal Region Connectez-vous pour afficher Polyclonal 0
1 ABIN2467862 ELISA Chicken AA 18-146 Connectez-vous pour afficher Polyclonal 0
1 ABIN2288634 ELISA WB Biotin Rabbit IgG Connectez-vous pour afficher Polyclonal 0

General

Antigène Interleukin 21 (IL21) Anticorps
Épitope AA 33-61
(19), (17), (15), (8), (8), (8), (7), (6), (6), (6), (5), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivité Souris
(213), (107), (29), (9), (4), (4), (4), (1), (1)
Hôte Chèvre
(177), (75), (39), (9), (5)
Clonalité
Polyclonal
Conjugué Cet anticorp IL21 est non-conjugé
(24), (14), (12), (12), (10), (9), (6), (5), (5), (5), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), ELISA
(201), (137), (51), (48), (33), (24), (15), (13), (10), (7), (6), (6), (5), (4), (4), (3), (2), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-IL21 anticorps

Détail du antigène IL21 Information d'application Stockage Images
Specificité Peptide sequence is <50 % identical to other interleukins in this region. The antibody recognizes mouse IL-21. Not tested for cross-reactivity to human IL-21.
Homologie Percent identity by BLAST analysis: Mouse (100%) Rat (93%) Hamster (86%).
Purification Immunoaffinity purified
Immunogène Synthetic peptide C-RHLIDIVEQLKIYENDLDPELLSAPQDVK corresponding to N-terminus of mouse IL-21. Percent identity by BLAST analysis: Mouse (100%), Rat (93%), Hamster (86%).

Type of Immunogen: Synthetic peptide
Plasmids, Primers & others

Détail du antigène IL21

Détail du produit anti-IL21 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation IL21 (IL21 Antibody Extrait)
Sujet Name/Gene ID: IL21
Family: Interleukin

Synonyms: IL21, Interleukin 21, Interleukin-21, Interleukin-21 isoform, Za11, IL-21
ID gène 59067
UniProt Q9HBE4
Pathways Signalistation JAK/STAT, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response

Information d'application

Détail du produit anti-IL21 anticorps Détail du antigène IL21 Stockage Images Haut de la page
Indications d'application Approved: ELISA (1:100000), IHC (1:500)
Commentaires

Target Species of Antibody: Mouse

Restrictions For Research Use only

Stockage

Détail du produit anti-IL21 anticorps Détail du antigène IL21 Information d'application Images Haut de la page
Format Liquid
Concentration Lot specific
Buffer 10 mM KHPO4, 140 mM NaCl. with 0.1 % sodium azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Conseil sur la manipulation Avoid freeze-thaw cycles.
Stock -20 °C,-80 °C
Stockage commentaire Short term: -20°C
Long term: -70°C
Avoid freeze-thaw cycles.

Images

Détail du produit anti-IL21 anticorps Détail du antigène IL21 Information d'application Stockage Haut de la page
Images (Fournisseur)
 image for anti-Interleukin 21 (IL21) (AA 33-61) antibody (ABIN342766) anti-Interleukin 21 (IL21) (AA 33-61) antibody