anti-Souris IL21 anticorps pour Immunochromatography

Recommended IL21 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Interleukin 21 (IL21) Anticorps
  • IL-21
  • Za11
  • interleukin 21
  • IL21
  • Il21
Épitope
N-Term
23
18
15
13
7
7
6
6
6
6
3
3
3
3
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
Reactivité
Souris
203
102
24
10
5
5
4
1
1
Hôte
Chèvre
165
70
41
10
5
Clonalité
Polyclonal
Conjugué
Cet anticorp IL21 est non-conjugé
20
15
13
11
10
9
6
6
5
5
5
3
3
3
3
3
3
3
3
3
3
1
1
1
1
1
1
Application
Immunochromatography (IC), ELISA
186
131
49
39
34
25
15
13
7
5
5
4
4
4
3
2
2
1
1
Fournisseur
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

N° du produit ABIN2288620
$ 586.14
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN2288622 IC ELISA Rabbit IgG C-Term Connectez-vous pour afficher Polyclonal

General

Antigène Interleukin 21 (IL21) Anticorps
Épitope N-Term
(23), (18), (15), (13), (7), (7), (6), (6), (6), (6), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivité Souris
(203), (102), (24), (10), (5), (5), (4), (1), (1)
Hôte Chèvre
(165), (70), (41), (10), (5)
Clonalité
Polyclonal
Conjugué Cet anticorp IL21 est non-conjugé
(20), (15), (13), (11), (10), (9), (6), (6), (5), (5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1)
Application Immunochromatography (IC), ELISA
(186), (131), (49), (39), (34), (25), (15), (13), (7), (5), (5), (4), (4), (4), (3), (2), (2), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-IL21 anticorps

Détail du antigène IL21 Information d'application Stockage Images
Séquence CRHLIDIVEQ LKIYENDLDP ELLSAPQDVK
 Réactivité croisée Souris
Réactivité croisée (Details) Calculated cross reactivity: Mo
Attributs du produit Interleukin 21 (IL-21), NT
Purification Purified by immunoaffinity chromatography.
Immunogène Synthetic peptide CRHLIDIVEQLKIYENDLDPELLSAPQDVK corresponding to N-terminus of mouse IL-21.
Isotype IgG

Détail du antigène IL21

Détail du produit anti-IL21 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation Interleukin 21 (IL21 Antibody Extrait)
Pathways Signalistation JAK/STAT, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response

Information d'application

Détail du produit anti-IL21 anticorps Détail du antigène IL21 Stockage Images Haut de la page
Indications d'application Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only

Stockage

Détail du produit anti-IL21 anticorps Détail du antigène IL21 Information d'application Images Haut de la page
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide before the addition of 40 % glycerol.
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock -20 °C
Stockage commentaire -20°C