anti-Souris IL21 anticorps pour Immunohistochemistry

Recommended IL21 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Interleukin 21 (IL21) Anticorps
  • IL-21
  • Za11
  • interleukin 21
  • IL21
  • Il21
Épitope
N-Term
23
18
15
13
7
7
6
6
6
6
3
3
3
3
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
Reactivité
Souris
203
102
24
10
5
5
4
1
1
Hôte
Chèvre
165
70
41
10
5
Clonalité
Polyclonal
Conjugué
Cet anticorp IL21 est non-conjugé
20
15
13
11
10
9
6
6
5
5
5
3
3
3
3
3
3
3
3
3
3
1
1
1
1
1
1
Application
ELISA, Immunohistochemistry (IHC)
186
131
49
38
34
25
15
13
7
6
5
4
4
4
3
2
2
1
1
Fournisseur
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN152155
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
8.809866 ABIN1030836 IHC ELISA WB Rabbit Extracellular Domain Connectez-vous pour afficher Polyclonal
1 ABIN315232 ICC IF IHC IHC (fro) IHC (p) WB Rabbit Center Connectez-vous pour afficher Polyclonal 5
1 ABIN342766 IHC ELISA Goat AA 33-61 Connectez-vous pour afficher Polyclonal
1 ABIN1868626 ICC IHC IP WB Rabbit IgG AA 25-146 Connectez-vous pour afficher Polyclonal
1 ABIN342765 IHC ELISA Rabbit AA 118-146 Connectez-vous pour afficher Polyclonal
1 ABIN2883051 IF IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal
1 ABIN2935467 ELISA IF/ICC IHC WB Rabbit AA 25-146 Connectez-vous pour afficher Polyclonal

General

Antigène Interleukin 21 (IL21) Anticorps
Épitope N-Term
(23), (18), (15), (13), (7), (7), (6), (6), (6), (6), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivité Souris
(203), (102), (24), (10), (5), (5), (4), (1), (1)
Hôte Chèvre
(165), (70), (41), (10), (5)
Clonalité
Polyclonal
Conjugué Cet anticorp IL21 est non-conjugé
(20), (15), (13), (11), (10), (9), (6), (6), (5), (5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1)
Application ELISA, Immunohistochemistry (IHC)
(186), (131), (49), (38), (34), (25), (15), (13), (7), (6), (5), (4), (4), (4), (3), (2), (2), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-IL21 anticorps

Détail du antigène IL21 Information d'application Stockage Images
Specificité Peptide sequence is < 50 % identical to other interleukins in this region and is therefore not expected to cross-react.
Purification Immunogen affinity purified
Immunogène Synthetic peptide: CRHLIDIVEQLKIYENDLDPELLSAPQDVK, corresponding to N terminal amino acids 32-61 of Mouse IL21.

Détail du antigène IL21

Détail du produit anti-IL21 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation IL-21 (IL21 Antibody Extrait)
Sujet Gene Symbol: IL21
ID gène 59067
Domaine de recherche Immunology, Cytokines, Inflammation, Virology, Cancer
Pathways Signalistation JAK/STAT, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response

Information d'application

Détail du produit anti-IL21 anticorps Détail du antigène IL21 Stockage Images Haut de la page
Indications d'application ELISA 1:100-1:2000, Immunohistochemistry 1:500
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-IL21 anticorps Détail du antigène IL21 Information d'application Images Haut de la page
Format Liquid
Concentration 1.0 mg/mL
Buffer 10 mM KHPO4, 0.14M NaCl and 1.0 mg/mL BSA
Buffer contains: 0.1 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Conseil sur la manipulation Avoid freeze-thaw cycles
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-IL21 anticorps Détail du antigène IL21 Information d'application Stockage Haut de la page
Supplier Images
Immunohistochemistry (IHC) image for anti-Interleukin 21 (IL21) (N-Term) antibody (ABIN152155) Immunohistochemistry with goat antibody N-terminus of mouse IL-21.