anti-Humain PLG anticorps pour Immunohistochemistry

Recommended PLG Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Plasminogen (PLG) Anticorps
  • wu:fb70e09
  • PLG
  • LPA
  • plg
  • Ab1-346
  • AI649309
  • Pg
  • plasminogen
  • plg
  • PLG
  • Plg
Reactivité
Humain
420
101
57
7
6
4
4
4
3
2
1
1
Hôte
Lapin
218
165
50
42
25
2
Clonalité
Polyclonal
Conjugué
Cet anticorp PLG est non-conjugé
36
26
24
10
10
7
7
6
6
6
6
6
6
6
6
6
6
5
4
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
311
227
138
124
36
28
27
20
19
17
17
15
14
13
8
5
4
4
4
3
3
2
2
1
1
1
1
Fournisseur
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4346086
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
8.732607 ABIN1078446 ICC IHC IP WB Rabbit IgG AA 274-560 Connectez-vous pour afficher Polyclonal
8.732607 ABIN4346088 IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal
8.732607 ABIN2433617 IHC ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal
1 ABIN4346087 ICC IF IHC IHC (p) WB Rabbit IgG Center Connectez-vous pour afficher Polyclonal
1 ABIN236063 IHC ELISA Mouse IgG1 Connectez-vous pour afficher 5H3
1 ABIN1860259 ICC IHC IP WB Rabbit IgG AA 79-466 Connectez-vous pour afficher Polyclonal
1 ABIN5596692 ELISA IHC WB HRP Goat IgG Connectez-vous pour afficher Polyclonal
1 ABIN265679 IHC (p) IP IHC ELISA Mouse IgG2a Connectez-vous pour afficher 9E7
1 ABIN265681 IHC (p) IHC ELISA Mouse IgG1 Connectez-vous pour afficher 8E7
1 ABIN2882233 IF IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal
1 ABIN4238494 ELISA IHC IHC (p) DyLight 488 Mouse IgG2a Connectez-vous pour afficher 9E7
1 ABIN4238495 ELISA IHC IHC (p) DyLight 550 Mouse IgG2a Connectez-vous pour afficher 9E7
1 ABIN4238497 ELISA IHC IHC (p) DyLight 680 Mouse IgG2a Connectez-vous pour afficher 9E7
1 ABIN4238498 ELISA IHC IHC (p) DyLight 755 Mouse IgG2a Connectez-vous pour afficher 9E7
1 ABIN4238500 ELISA IHC IHC (p) Alexa Fluor 488 Mouse IgG2a Connectez-vous pour afficher 9E7
1 ABIN4238502 ELISA IHC IHC (p) Alexa Fluor 700 Mouse IgG2a Connectez-vous pour afficher 9E7
1 ABIN4238508 ELISA IHC IHC (p) FITC Mouse IgG2a Connectez-vous pour afficher 9E7
1 ABIN4238499 ELISA IHC IHC (p) Alexa Fluor 405 Mouse IgG2a Connectez-vous pour afficher 9E7
1 ABIN4238501 ELISA IHC IHC (p) Alexa Fluor 647 Mouse IgG2a Connectez-vous pour afficher 9E7
1 ABIN4238507 ELISA IHC IHC (p) Biotin Mouse IgG2a Connectez-vous pour afficher 9E7

General

Antigène Plasminogen (PLG) Anticorps
Reactivité Humain
(420), (101), (57), (7), (6), (4), (4), (4), (3), (2), (1), (1)
Hôte Lapin
(218), (165), (50), (42), (25), (2)
Clonalité
Polyclonal
Conjugué Cet anticorp PLG est non-conjugé
(36), (26), (24), (10), (10), (7), (7), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (5), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(311), (227), (138), (124), (36), (28), (27), (20), (19), (17), (17), (15), (14), (13), (8), (5), (4), (4), (4), (3), (3), (2), (2), (1), (1), (1), (1)
Pubmed 1 référence disponible
Fournisseur Connectez-vous pour afficher

Détail du produit anti-PLG anticorps

Détail du antigène PLG Information d'application Stockage References for anti-PLG antibody (ABIN4346086) Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE
Isotype IgG

Détail du antigène PLG

Détail du produit anti-PLG anticorps Information d'application Stockage References for anti-PLG antibody (ABIN4346086) Images Haut de la page
Antigène
Autre désignation Plasminogen (PLG Antibody Extrait)
Sujet Gene Symbol: PLG
ID gène 5340
Domaine de recherche Angiogenesis, Proteolysis / Ubiquitin, Proteases, Coagulation
Pathways Système du Complément

Information d'application

Détail du produit anti-PLG anticorps Détail du antigène PLG Stockage References for anti-PLG antibody (ABIN4346086) Images Haut de la page
Indications d'application Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-PLG anticorps Détail du antigène PLG Information d'application References for anti-PLG antibody (ABIN4346086) Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PLG antibody (ABIN4346086)

Détail du produit anti-PLG anticorps Détail du antigène PLG Information d'application Stockage Images Haut de la page
Produit citée dans:

Gründel, Friedrich, Pfeiffer, Jacobs, Dumke: "Subunits of the Pyruvate Dehydrogenase Cluster of Mycoplasma pneumoniae Are Surface-Displayed Proteins that Bind and Activate Human Plasminogen." dans: PLoS ONE, Vol. 10, Issue 5, pp. e0126600, 2015 (Échantillon (espèces): Human). Détails: ELISA

Images

Détail du produit anti-PLG anticorps Détail du antigène PLG Information d'application Stockage References for anti-PLG antibody (ABIN4346086) Haut de la page
Supplier Images
Immunohistochemistry (IHC) image for anti-Plasminogen (PLG) antibody (ABIN4346086) Immunohistochemistry: Plasminogen Antibody [NBP1-86015] - Staining of human colon sho...