anti-Rat (Rattus) C4A anticorps pour Western Blotting

Recommended C4A Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Complement Fragment 4a (C4A) Anticorps
  • C4
  • C4A2
  • C4A3
  • C4A4
  • C4A6
  • C4AD
  • C4S
  • CO4
  • CPAMD2
  • RG
  • Slp
  • C4-1
  • C4b
  • complement C4A (Rodgers blood group)
  • complement component 4A (Rodgers blood group)
  • C4A
  • C4a
Reactivité
Humain, Souris, Rat (Rattus)
32
5
4
1
Hôte
Lapin
24
12
1
1
Clonalité
Polyclonal
Conjugué
Cet anticorp C4A est non-conjugé
2
2
1
Application
Western Blotting (WB)
20
19
16
9
8
7
6
2
2
1
Options
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher

Images

N° du produit ABIN5693263
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN2749473 ELISA IHC IP WB FITC Rabbit IgG AA 1220-1270 Connectez-vous pour afficher Polyclonal 0
1 ABIN2749472 ELISA IHC IP WB Rabbit IgG AA 1220-1270 Connectez-vous pour afficher Polyclonal 0
1 ABIN6340221 IF/ICC IHC IP WB Rabbit Connectez-vous pour afficher Polyclonal 0
1 ABIN6332123 IF/ICC IHC IP WB Mouse Connectez-vous pour afficher 0
1 ABIN5558738 ELISA IHC IP WB Biotin Rabbit Connectez-vous pour afficher Polyclonal 0

General

Antigène Complement Fragment 4a (C4A) Anticorps
Reactivité Humain, Souris, Rat (Rattus)
(32), (5), (4), (1)
Hôte Lapin
(24), (12), (1), (1)
Clonalité
Polyclonal
Conjugué Cet anticorp C4A est non-conjugé
(2), (2), (1)
Application Western Blotting (WB)
(20), (19), (16), (9), (8), (7), (6), (2), (2), (1)
Pubmed 2 références disponible
Fournisseur Connectez-vous pour afficher

Détail du produit anti-C4A anticorps

Détail du antigène C4A Information d'application Stockage References for anti-C4A antibody (ABIN5693263) Images
Marque Picoband™
Séquence YMRIQQFRKA DGSYAAWLSR DSSTWLTAFV LKVLSLAQEQ
Réactivité croisée (Details) No cross reactivity with other proteins.
Attributs du produit Rabbit IgG polyclonal antibody for C4A detection. Tested with WB in Human,Mouse,Rat.
Immunogène A synthetic peptide corresponding to a sequence of human C4A (YMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQ).
Plasmids, Primers & others

Détail du antigène C4A

Détail du produit anti-C4A anticorps Information d'application Stockage References for anti-C4A antibody (ABIN5693263) Images Haut de la page
Antigène
Autre désignation C4A (C4A Antibody Extrait)
Sujet

Synonyms: Complement C4-A, Acidic complement C4, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2, Complement C4 beta chain, Complement C4-A alpha chain, C4a anaphylatoxin, C4b-A, C4d-A, Complement C4 gamma chain, C4A, CO4, CPAMD2

Tissue Specificity: Complement component C4 is expressed at highest levels in the liver, at moderate levels in the adrenal cortex, adrenal medulla, thyroid gland,and the kidney, and at lowest levels in the heart, ovary, small intestine, thymus, pancreas and spleen. The extra-hepatic sites of expression may be important for the local protection and inflammatory response.

Background: Complement C4-A is a protein that in humans is encoded by the C4A gene. This gene encodes the acidic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus and type I diabetes mellitus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. Two transcript variants encoding different isoforms have been found for this gene.

UniProt P0C0L4
Pathways Système du Complément

Information d'application

Détail du produit anti-C4A anticorps Détail du antigène C4A Stockage References for anti-C4A antibody (ABIN5693263) Images Haut de la page
Indications d'application

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5&mu,g/mL

Restrictions For Research Use only

Stockage

Détail du produit anti-C4A anticorps Détail du antigène C4A Information d'application References for anti-C4A antibody (ABIN5693263) Images Haut de la page
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Buffer Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

References for anti-C4A antibody (ABIN5693263)

Détail du produit anti-C4A anticorps Détail du antigène C4A Information d'application Stockage Images Haut de la page
Produit citée dans:

Liang, Zhang, Wang: "Alternative complement activity in the egg cytosol of amphioxus Branchiostoma belcheri: evidence for the defense role of maternal complement components." dans: PLoS ONE, Vol. 4, Issue 1, pp. e4234, 2009

Wang, Zhang, Wang, An: "Complement activity in the egg cytosol of zebrafish Danio rerio: evidence for the defense role of maternal complement components." dans: PLoS ONE, Vol. 3, Issue 1, pp. e1463, 2008

Images

Détail du produit anti-C4A anticorps Détail du antigène C4A Information d'application Stockage References for anti-C4A antibody (ABIN5693263) Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-Complement Fragment 4a (C4A) antibody (ABIN5693263) Western blot analysis of C4A using anti-C4A antibody . Electrophoresis was performed...