anti-Humain Kallikrein 10 anticorps pour Western Blotting

Recommended Kallikrein 10 Antibody

Antigène
Kallikrein 10 (KLK10) Anticorps
  • KLK10
  • 2300002A13Rik
  • NES1
  • PRSSL1
  • kallikrein related peptidase 10
  • kallikrein related-peptidase 10
  • kallikrein-related peptidase 10
  • KLK10
  • Klk10
Épitope
N-Term
12
10
9
7
7
7
6
4
4
4
3
2
2
1
1
Reactivité
Humain
112
21
21
1
1
1
1
Hôte
Lapin
103
12
1
Clonalité
Polyclonal
Conjugué
Cet anticorp Kallikrein 10 est non-conjugé
11
9
7
4
4
3
2
2
2
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
83
46
30
14
13
9
9
4
4
3
2
2
2
Options

Images

N° du produit ABIN634235
$ 449.29
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
16.877518 ABIN1173435 ICC IHC WB Rabbit IgG AA 35-276 Polyclonal 0
16.877518 ABIN2563584 IF IHC WB Rabbit IgG Polyclonal 0
16.877518 ABIN2936132 IF/ICC IHC IP WB Rabbit AA 35-276 Polyclonal 0
13.877518 ABIN562462 IF ELISA WB Mouse IgG Mix lambda AA 167-276 1G8 0
13.877518 ABIN562461 ELISA WB Mouse AA 167-276 Polyclonal 0
13.656364 ABIN6142943 IF IHC WB Rabbit Polyclonal 0
13.656364 ABIN6142942 IF IHC WB Rabbit Polyclonal 0
10.877518 ABIN6004312 IF/ICC IHC WB Rabbit IgG full length Polyclonal 0
10.877518 ABIN2966766 IC IF IHC WB Rabbit Polyclonal 0
10 ABIN6290548 IF IHC WB Rabbit IgG Polyclonal 0
8.5 ABIN741630 IF (p) IHC (p) WB Rabbit IgG Polyclonal 2
7.8775177 ABIN2969141 IF/ICC IHC WB Rabbit IgG Polyclonal 0
7.8775177 ABIN519342 ELISA WB Mouse IgG Mix lambda AA 167-276 1G8 0
7.8775177 ABIN6570410 IHC WB Rabbit IgG Polyclonal 0
7.8775177 ABIN2998072 WB Rabbit IgG Polyclonal 0
7.8775177 ABIN3031526 WB Rabbit IgG C-Term Polyclonal 0
7 ABIN5531500 WB Rabbit Ig Fraction AA 22-51, N-Term Polyclonal 0
7 ABIN519343 ELISA WB Mouse IgG Mix lambda AA 167-276 1B9 0
4.8775177 ABIN2786710 WB Rabbit N-Term Polyclonal 1
4.8775177 ABIN3043037 WB Rabbit IgG AA 252-265, C-Term Polyclonal 0

General

Antigène Kallikrein 10 (KLK10) Anticorps
Épitope N-Term
(12), (10), (9), (7), (7), (7), (6), (4), (4), (4), (3), (2), (2), (1), (1)
Reactivité Humain
(112), (21), (21), (1), (1), (1), (1)
Hôte Lapin
(103), (12), (1)
Clonalité
Polyclonal
Conjugué Cet anticorp Kallikrein 10 est non-conjugé
(11), (9), (7), (4), (4), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(83), (46), (30), (14), (13), (9), (9), (4), (4), (3), (2), (2), (2)
Fournisseur

Détail du produit anti-Kallikrein 10 anticorps

Détail du antigène Kallikrein 10 Information d'application Stockage Images
Specificité KLK10 antibody was raised against the N terminal of KLK10
Purification Affinity purified
Immunogène KLK10 antibody was raised using the N terminal of KLK10 corresponding to a region with amino acids LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA
Plasmids, Primers & others

Détail du antigène Kallikrein 10

Détail du produit anti-Kallikrein 10 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation KLK10 (KLK10 Antibody Extrait)
Sujet Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.
Poids moléculaire 30 kDa (MW of target protein)
Pathways Système du Complément

Information d'application

Détail du produit anti-Kallikrein 10 anticorps Détail du antigène Kallikrein 10 Stockage Images Haut de la page
Indications d'application WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Commentaires

KLK10 Blocking Peptide, catalog no. 33R-5176, is also available for use as a blocking control in assays to test for specificity of this KLK10 antibody

Restrictions For Research Use only

Stockage

Détail du produit anti-Kallikrein 10 anticorps Détail du antigène Kallikrein 10 Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK10 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Détail du produit anti-Kallikrein 10 anticorps Détail du antigène Kallikrein 10 Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-Kallikrein 10 (KLK10) (N-Term) antibody (ABIN634235) KLK10 antibody used at 1 ug/ml to detect target protein.