anti-Humain IL17A anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended IL17A Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Interleukin 17A (IL17A) Anticorps
  • CTLA8
  • IL-17
  • IL-17A
  • IL17
  • Ctla-8
  • Ctla8
  • Il17
  • ChIL-17
  • IL-17F
  • IL17A
  • CTLA-8
  • interleukin 17A
  • IL17A
  • Il17a
Reactivité
Humain
370
131
40
7
7
5
3
3
2
2
Hôte
Lapin
248
130
77
40
3
3
Clonalité
Polyclonal
Conjugué
Cet anticorp IL17A est non-conjugé
56
32
27
22
20
16
15
15
11
11
7
7
7
7
7
5
5
5
4
4
4
4
4
4
3
2
2
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
268
228
195
41
30
19
18
16
8
8
7
7
7
6
6
4
4
4
3
3
2
1
1
1
1
1
1
1
Fournisseur
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4324633
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN1490779 IHC (p) WB Mouse IgG2b, kappa AA 1-75 Connectez-vous pour afficher 4K5F6
1 ABIN116119 EIA Func IHC (p) WB Rabbit Connectez-vous pour afficher Polyclonal
1 ABIN116120 EIA Func IHC (p) WB Rabbit Connectez-vous pour afficher Polyclonal
1 ABIN1102463 IHC (p) Neut ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal
1 ABIN181572 EIA IHC (p) Neut WB Goat Connectez-vous pour afficher Polyclonal
1 ABIN5580751 FACS IHC (p) WB Mouse IgG2b kappa Connectez-vous pour afficher 4K5F6

General

Antigène Interleukin 17A (IL17A) Anticorps
Reactivité Humain
(370), (131), (40), (7), (7), (5), (3), (3), (2), (2)
Hôte Lapin
(248), (130), (77), (40), (3), (3)
Clonalité
Polyclonal
Conjugué Cet anticorp IL17A est non-conjugé
(56), (32), (27), (22), (20), (16), (15), (15), (11), (11), (7), (7), (7), (7), (7), (5), (5), (5), (4), (4), (4), (4), (4), (4), (3), (2), (2), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(268), (228), (195), (41), (30), (19), (18), (16), (8), (8), (7), (7), (7), (6), (6), (4), (4), (4), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-IL17A anticorps

Détail du antigène IL17A Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids: NPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRN EDPERYPSVIWEAKCRHLGCIN
Isotype IgG

Détail du antigène IL17A

Détail du produit anti-IL17A anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation IL-17/IL-17A (IL17A Antibody Extrait)
Sujet Gene Symbol: IL17A
ID gène 3605

Information d'application

Détail du produit anti-IL17A anticorps Détail du antigène IL17A Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-IL17A anticorps Détail du antigène IL17A Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-IL17A anticorps Détail du antigène IL17A Information d'application Stockage Haut de la page
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interleukin 17A (IL17A) antibody (ABIN4324633) Immunohistochemistry-Paraffin: IL-17/IL-17A Antibody [NBP2-14121] - Staining of human...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Interleukin 17A (IL17A) antibody (ABIN4324633) Immunohistochemistry-Paraffin: IL-17/IL-17A Antibody [NBP2-14121] - Staining of human...