anti-Souris ITK anticorps pour Western Blotting

Recommended ITK Antibody (fourni par: Connectez-vous pour afficher )

Antigène
IL2-Inducible T-Cell Kinase (ITK) Anticorps
  • Emt
  • Tcsk
  • Tsk
  • EMT
  • LPFS1
  • LYK
  • PSCTK2
  • IL2 inducible T cell kinase
  • IL2 inducible T-cell kinase
  • IL2-inducible T-cell kinase
  • Itk
  • ITK
Épitope
AA 575-617, C-Term
23
17
17
12
9
8
5
4
4
3
2
2
2
1
1
1
1
1
1
1
1
Reactivité
Humain, Souris
116
26
25
3
2
Hôte
Lapin
72
35
24
Clonalité
Polyclonal
Conjugué
Cet anticorp ITK est non-conjugé
8
7
6
6
6
6
Application
Western Blotting (WB)
116
85
15
10
8
6
6
5
4
3
1
Options
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN5518767
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
3.1493068 ABIN1873325 WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
3.1493068 ABIN1868785 ICC IHC WB Rabbit IgG AA 368-625 Connectez-vous pour afficher Polyclonal 0
3.1493068 ABIN2563488 ELISA WB Goat IgG C-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN5552654 WB Goat C-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN680653 IF (p) IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN5928223 WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2746783 ELISA IHC IP WB FITC Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN5928221 WB Rabbit pTyr512 Connectez-vous pour afficher Polyclonal 0
1 ABIN6101383 ELISA IHC WB Rabbit IgG pTyr512 Connectez-vous pour afficher Polyclonal 0
1 ABIN2746782 ELISA IHC IP WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2624369 WB Rabbit AA 156-190 Connectez-vous pour afficher Polyclonal 0
1 ABIN1906120 WB Rabbit AA 1-50 Connectez-vous pour afficher Polyclonal 0
1 ABIN5703865 ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2934404 ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1087337 ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2934403 IF/ICC IHC IP WB Rabbit AA 368-625 Connectez-vous pour afficher Polyclonal 0
1 ABIN5647872 WB Rabbit IgG AA 575-617 Connectez-vous pour afficher Polyclonal 0
1 ABIN6055997 IF/ICC IHC WB Biotin Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN5928225 ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN6031874 IF/ICC IHC IP WB Rabbit Connectez-vous pour afficher Polyclonal 0

General

Antigène IL2-Inducible T-Cell Kinase (ITK) Anticorps
Épitope AA 575-617, C-Term
(23), (17), (17), (12), (9), (8), (5), (4), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivité Humain, Souris
(116), (26), (25), (3), (2)
Hôte Lapin
(72), (35), (24)
Clonalité
Polyclonal
Conjugué Cet anticorp ITK est non-conjugé
(8), (7), (6), (6), (6), (6)
Application Western Blotting (WB)
(116), (85), (15), (10), (8), (6), (6), (5), (4), (3), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-ITK anticorps

Détail du antigène ITK Information d'application Stockage Images
Fonction Rabbit IgG polyclonal antibody for Tyrosine-protein kinase ITK/TSK(ITK) detection. Tested with WB in Human,Mouse.
Séquence FRLYKPRLAS THVYQIMNHC WKERPEDRPA FSRLLRQLAE IAE
Réactivité croisée (Details) No cross reactivity with other proteins.
Attributs du produit Rabbit IgG polyclonal antibody for Tyrosine-protein kinase ITK/TSK(ITK) detection. Tested with WB in Human,Mouse.
Gene Name: IL2 inducible T-cell kinase
Protein Name: Tyrosine-protein kinase ITK/TSK
Purification Immunogen affinity purified.
Immunogène A synthetic peptide corresponding to a sequence at the C-terminus of human ITK (575-617aa FRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAE), different from the related mouse sequence by five amino acids.
Isotype IgG
Plasmids, Primers & others

Détail du antigène ITK

Détail du produit anti-ITK anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation ITK (ITK Antibody Extrait)
Sujet Tyrosine-protein kinase ITK/TSK, also known as interleukin-2-inducible T-cell kinase or simply ITK, is a protein that in humans is encoded by the ITK gene. It is a member of the TEC family of kinases. This gene is mapped to 5q33.3. This gene encodes an intracellular tyrosine kinase expressed in T-cells. The protein is thought to play a role in T-cell proliferation and differentiation. Furthermore, ITK is functionally important for the development and effector function of Th2 and Th17 cells.

Synonyms: EMT | Itk | LPFS1 | LYK | PSCTK 2 | PSCTK2 | TSK | Q08881
ID gène 3702
UniProt Q08881
Pathways TCR Signaling, Fc-epsilon Receptor Signaling Pathway

Information d'application

Détail du produit anti-ITK anticorps Détail du antigène ITK Stockage Images Haut de la page
Indications d'application WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.
Commentaires

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions For Research Use only

Stockage

Détail du produit anti-ITK anticorps Détail du antigène ITK Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Images

Détail du produit anti-ITK anticorps Détail du antigène ITK Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-IL2-Inducible T-Cell Kinase (ITK) (AA 575-617), (C-Term) antibody (ABIN5518767) Western blot analysis of ITK expression in HELA whole cell lysates ( Lane 1) and NIH3...