anti-Humain Ectodysplasin A anticorps pour Immunocytochemistry

Recommended Ectodysplasin A Antibody (fourni par: Connectez-vous pour afficher )

Ectodysplasin A (EDA) Anticorps
  • ECTD1
  • ED1
  • ED1-A1
  • ED1-A2
  • EDA-A1
  • EDA-A2
  • EDA1
  • EDA2
  • HED
  • HED1
  • ODT1
  • XHED
  • si:ch73-223d24.5
  • Ed1
  • Eda-A1
  • Eda-A2
  • Ta
  • tabby
  • RGD1563178
  • ectodysplasin A
  • ectodysplasin-A
  • EDA
  • eda
  • Eda
Cet anticorp Ectodysplasin A est non-conjugé
Immunocytochemistry (ICC), Immunofluorescence (IF)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus


N° du produit ABIN5076431
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
-9.842285 ABIN5076430 ICC IF Rabbit IgG Connectez-vous pour afficher Polyclonal 0


Antigène Ectodysplasin A (EDA) Anticorps
Reactivité Humain
(163), (90), (52), (7), (7), (7), (7), (7), (6), (4), (3), (3), (3), (2), (1), (1), (1)
Hôte Lapin
(104), (64)
Conjugué Cet anticorp Ectodysplasin A est non-conjugé
(10), (7), (7), (5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(95), (72), (48), (32), (26), (23), (4), (3), (2), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-Ectodysplasin A anticorps

Détail du antigène Ectodysplasin A Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogène This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS
Isotype IgG
Plasmids, Primers & others

Détail du antigène Ectodysplasin A

Détail du produit anti-Ectodysplasin A anticorps Information d'application Stockage Images Haut de la page
Autre désignation EDA/Ectodysplasin (EDA Antibody Extrait)
Sujet Gene Symbol: EDA
ID gène 1896
Pathways Tube Formation

Information d'application

Détail du produit anti-Ectodysplasin A anticorps Détail du antigène Ectodysplasin A Stockage Images Haut de la page
Indications d'application Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Détail du produit anti-Ectodysplasin A anticorps Détail du antigène Ectodysplasin A Information d'application Images Haut de la page
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Détail du produit anti-Ectodysplasin A anticorps Détail du antigène Ectodysplasin A Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Ectodysplasin A (EDA) antibody (ABIN5076431) Immunocytochemistry/Immunofluorescence: EDA/Ectodysplasin Antibody - Staining of hum...