AGAP2 anticorps (Middle Region)
Aperçu rapide pour AGAP2 anticorps (Middle Region) (ABIN632064)
Antigène
Voir toutes AGAP2 AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Épitope
- Middle Region
-
Specificité
- CENTG1 antibody was raised against the middle region of CENTG1
-
Purification
- Affinity purified
-
Immunogène
- CENTG1 antibody was raised using the middle region of CENTG1 corresponding to a region with amino acids AHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQG
-
-
anti-ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2) (Internal Region) antibody
Verified AGAP2 Reactivité: Humain WB, ELISA, IHC Hôte: Chèvre Polyclonal unconjugated
anti-ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2) (AA 20-60) antibodyAGAP2 Reactivité: Humain, Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2) (AA 450-500) antibodyAGAP2 Reactivité: Humain, Souris, Rat, Cheval, Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2) (AA 850-877), (C-Term) antibodyAGAP2 Reactivité: Humain, Souris WB Hôte: Lapin Polyclonal RB19565 unconjugated
anti-ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2) (AA 719-768) antibodyAGAP2 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Singe, Roussette (Chauve-souris) WB Hôte: Lapin Polyclonal unconjugated
anti-ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2) (C-Term) antibodyAGAP2 Reactivité: Humain, Souris WB, IHC (p), EIA Hôte: Lapin Polyclonal unconjugated
-
-
Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
CENTG1 Blocking Peptide, (ABIN936626), is also available for use as a blocking control in assays to test for specificity of this CENTG1 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENTG1 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- AGAP2 (ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 2 (AGAP2))
-
Autre désignation
- CENTG1
-
Sujet
- CENTG1 is a GTPase-activating protein (GAP) for ARF1 and ARF5, which also shows strong GTPase activity. Isoform 1 participates in the prevention of neuronal apoptosis by enhancing PI3 kinase activity. It aids the coupling of metabotropic glutamate receptor 1 (GRM1) to cytoplasmic PI3 kinase by interacting with Homer scaffolding proteins, and also seems to mediate anti-apoptotic effects of NGF by activating nuclear PI3 kinase. Isoform 2 does not stimulate PI3 kinase but may protect cells from apoptosis by stimulating Akt. It also regulates the adapter protein 1 (AP-1)-dependent trafficking of proteins in the endosomal system. It seems to be oncogenic. It is overexpressed in cancer cells, prevents apoptosis and promotes cancer cell invasion.
-
Poids moléculaire
- 90 kDa (MW of target protein)
Antigène
-
