AGPAT5 anticorps
Aperçu rapide pour AGPAT5 anticorps (ABIN635826)
Antigène
Voir toutes AGPAT5 AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Purification
- Affinity purified
-
Immunogène
- AGPAT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLSAFLPARFYQALDDRLYCVYQSMVLFFFENYTGVQILLYGDLPKNKE
-
-
anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5) antibody
AGPAT5 Reactivité: Humain WB, IHC, IHC (p), FACS Hôte: Souris Monoclonal 1D12 unconjugated
anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5) antibodyAGPAT5 Reactivité: Humain WB, IHC, IHC (p), IF Hôte: Souris Monoclonal 2C4 unconjugated
anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5) (Internal Region) antibodyAGPAT5 Reactivité: Humain, Souris WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5) (AA 174-313) antibodyAGPAT5 Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5) (AA 1-364) antibodyAGPAT5 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5) antibodyAGPAT5 Reactivité: Humain, Rat, Souris WB Hôte: Lapin Polyclonal unconjugated
anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5) (AA 36-85) antibodyAGPAT5 Reactivité: Humain, Rat, Boeuf (Vache), Porc WB Hôte: Lapin Polyclonal unconjugated
anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5) (AA 45-264) antibodyAGPAT5 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5) (AA 28-55), (N-Term) antibodyAGPAT5 Reactivité: Humain WB Hôte: Lapin Polyclonal RB38674 unconjugated
-
-
Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
AGPAT5 Blocking Peptide, (ABIN5611973), is also available for use as a blocking control in assays to test for specificity of this AGPAT5 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGPAT5 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
-
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- AGPAT5 (1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5))
-
Autre désignation
- AGPAT5
-
Sujet
- Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis.
-
Poids moléculaire
- 42 kDa (MW of target protein)
Antigène
-
