LGALS3BP anticorps (Middle Region)
(1 reference)Aperçu rapide pour LGALS3BP anticorps (Middle Region) (ABIN634658)
Antigène
Voir toutes LGALS3BP AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Épitope
- Middle Region
-
Specificité
- LGALS3 BP antibody was raised against the middle region of LGALS3 P
-
Purification
- Affinity purified
-
Immunogène
- LGALS3 BP antibody was raised using the middle region of LGALS3 P corresponding to a region with amino acids NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS
-
-
anti-Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP) (AA 383-412) antibody
LGALS3BP Reactivité: Humain, Souris WB, IHC (p) Hôte: Lapin Polyclonal RB40516 unconjugated
anti-Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP) (AA 24-221) antibodyLGALS3BP Reactivité: Humain WB, IHC Hôte: Souris Monoclonal D4 unconjugated
anti-Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP) (C-Term) antibodyLGALS3BP Reactivité: Humain, Souris WB, IHC, ICC, IF Hôte: Lapin Polyclonal unconjugated
anti-Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP) (AA 301-400) antibodyLGALS3BP Reactivité: Humain, Souris, Rat WB, ELISA, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP) (AA 1-585) antibodyLGALS3BP Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP) (AA 1-585) antibodyLGALS3BP Reactivité: Humain WB, IP Hôte: Lapin Polyclonal unconjugated
anti-Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP) antibodyLGALS3BP Reactivité: Humain, Souris, Rat IF Hôte: Lapin Polyclonal unconjugated
anti-Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP) (AA 362-411) antibodyLGALS3BP Reactivité: Humain, Souris, Chien WB Hôte: Lapin Polyclonal unconjugated
anti-Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP) antibodyLGALS3BP Reactivité: Humain WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP) (AA 19-577) antibodyLGALS3BP Reactivité: Souris WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
-
-
Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
LGALS3BP Blocking Peptide, (ABIN5614449), is also available for use as a blocking control in assays to test for specificity of this LGALS3BP antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS0 P antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
-
: "Extracellular matrix proteomics identifies molecular signature of symptomatic carotid plaques. ..." dans: The Journal of clinical investigation, Vol. 127, Issue 4, pp. 1546-1560, (2017) (PubMed).
-
-
- LGALS3BP (Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP))
-
Autre désignation
- LGALS3BP
-
Sujet
- The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.
-
Poids moléculaire
- 63 kDa (MW of target protein)
Antigène
-
