TSHB anticorps (AA 20-134)

N° du produit ABIN1078576

Cet anticorps Lapin Polyclonal détecte spécifiquement TSHB dans WB, IHC, ICC et IP. Il présente une réactivité envers Poulet.

Aperçu rapide pour TSHB anticorps (AA 20-134) (ABIN1078576)

Antigène: TSHB (Thyroid Stimulating Hormone, beta (TSHB))

Reactivité: Poulet

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSHB est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunoprecipitation (IP)

Détail du produit anti-TSHB anticorps

Épitope: AA 20-134

Fonction: Polyclonal Antibody to Thyroid Stimulating Hormone Beta (TSHb)

Séquence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDD DDKAMADIGSEF-S VCAPSEYTIH VEKRECAYCL AINTTICAGF CMTRDSNGKK LLLKSALSQN VCTYKEMFYQ TALIPGCPHH TIPYYSYPVA ISCKCGKCNT DYSDCVHEKV RTNYCTKPQK LCNM

Specificité: The antibody is a rabbit polyclonal antibody raised against TSHb. It has been selected for its ability to recognize TSHb in immunohistochemical staining and western blotting.

Purification: Antigen-specific affinity chromatography followed by Protein A affinity chromatography

Immunogène: RPD213Ga01Recombinant Thyroid Stimulating Hormone Beta (TSHb)

Isotype: IgG

Information d'application

Indications d'application: Western blotting: 0.5-2 μg/mL,Immunohistochemistry: 5-20 μg/mL,Immunocytochemistry: 5-20 μg/mL,Optimal working dilutions must be determined by end user.

Commentaires:

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 500 μg/mL

Buffer: 0.01M PBS, pH 7.4, containing 0.05 % Proclin-300, 50 % glycerol.

Agent conservateur: ProClin

Précaution d'utilisation: WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Date de péremption: 12 months

Détails sur TSHB

Antigène: TSHB (Thyroid Stimulating Hormone, beta (TSHB))

Autre désignation: TSHb

Sujet: TSH-B, Thyrotropin beta chain, Thyrotropin alfa

Pathways: Thyroid Hormone Synthesis, Peptide Hormone Metabolism