TSHB anticorps (AA 20-134)

N° du produit ABIN1078576

Détail du produit anti-TSHB anticorps

Antigène: TSHB (Thyroid Stimulating Hormone, beta (TSHB))

Épitope: AA 20-134

Reactivité: Poulet

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSHB est non-conjugé

Application: ELISA, Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))

Séquence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDD DDKAMADIGSEF-S VCAPSEYTIH VEKRECAYCL AINTTICAGF CMTRDSNGKK LLLKSALSQN VCTYKEMFYQ TALIPGCPHH TIPYYSYPVA ISCKCGKCNT DYSDCVHEKV RTNYCTKPQK LCNM

Specificité: It has been selected for its ability to recognize TSHb in immunohistochemical staining and Western blotting.

Purification: Affinity Chromatography

Immunogène: Recombinant TSHb expressed in E.coli.
The antibody is a rabbit polyclonal antibody raised against TSHb.

Isotype: IgG

Information d'application

Indications d'application: Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Optimal working dilutions must be determined by end user.

Commentaires:

Content: The quality control contains recombinant TSHb (Ser20~Met134) disposed in loading buffer.
Usage: 10 µL per well when 3,3'-Diaminobenzidine(DAB) as the substrate. 5 µL per well when used in enhanced chemilumescent (ECL).
Note: The quality control is specifically manufactured as the positive control.Not used for other purposes.
Loading Buffer: 100 mM Tris(pH8.8), 2 % SDS, 200 mM NaCl, 50 % glycerol,BPB 0.01 % , NaN3 0.02 % .

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: Supplied as solution form in PBS, pH7.4, containing 0.02 % NaN3, 50 % glycerol.

Agent conservateur: Sodium azide

Précaution d'utilisation: WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles

Stock: 4 °C

Stockage commentaire: Store at 2-8 °C for one month. Aliquot and store at -80 °C for 12 months.

Date de péremption: 12 months

Détails sur TSHB

Antigène: TSHB (Thyroid Stimulating Hormone, beta (TSHB))

Autre désignation: Thyroid Stimulating Hormone Beta (TSHb) (TSHB Produits)

Synonymes: anticorps TSH-B, anticorps TSH-BETA, anticorps TSHB, anticorps thyroid stimulating hormone beta, anticorps thyroid stimulating hormone, beta, anticorps thyroid stimulating hormone, beta subunit, anticorps TSHB, anticorps Tshb, anticorps tshb

Pathways: Thyroid Hormone Synthesis, Peptide Hormone Metabolism