Parathyroid Hormone 2 (PTH2) anticorps

N° du produit ABIN109738

Cet anticorps anti- est un anticorps Lapin Polyclonal détectant dans ELISA, IHC (p) et RIA. Adapté pour Humain.

Aperçu rapide pour Parathyroid Hormone 2 (PTH2) anticorps (ABIN109738)

Antigène: Parathyroid Hormone 2 (PTH2)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA)

Détail du produit

Specificité: Human, bovine, canis TIP 39

Immunogène: synthetic human TIP 39 (aa 62-100) KLH conjugated (SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP)

Information d'application

Indications d'application: ELISA (1/5.000) RIA, Immunohistochemistry (paraffin section, 1:100) This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Stock: 4 °C

Détail du antigène

Antigène: Parathyroid Hormone 2 (PTH2)

Autre désignation: TIP 39

Sujet: Serum

Pathways: Sensory Perception of Sound, cAMP Metabolic Process, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development