PRO-ANP anticorps (AA 1-30)

N° du produit ABIN109956

L’anticorps Mouton Polyclonal anti-PRO-ANP a été validé pour ELISA et RIA. Il convient pour détecter PRO-ANP dans des échantillons de Humain.

Aperçu rapide pour PRO-ANP anticorps (AA 1-30) (ABIN109956)

Antigène: PRO-ANP (Pro-Atrial Natriuretic Peptide (PRO-ANP))

Reactivité: Humain

Hôte: Mouton

Clonalité: Polyclonal

Conjugué: Cet anticorp PRO-ANP est non-conjugé

Application: ELISA, Radioimmunoassay (RIA)

Détail du produit anti-PRO-ANP anticorps

Épitope: AA 1-30

Specificité: Synthetic human pro-ANP (aa 1-30) There were no cross reactivities obtained with human pro-ANP (aa 31-67, 67-98) and human ANP (aa 1-28)

Immunogène: Synthetic human pro-ANP (aa 1-30) poly Lysin conjugated (npmynavsnadlmdfknlldhleekmpled)

Information d'application

Indications d'application: RIA (1/5000) ELISA This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Stock: 4 °C

Détails sur PRO-ANP

Antigène: PRO-ANP (Pro-Atrial Natriuretic Peptide (PRO-ANP))

Autre désignation: Pro-Atrial Natriuretic Peptide

Sujet: Serum

ID gène: 4878