BNP32 anticorps

N° du produit ABIN1100299

Cet anticorps Lapin Polyclonal détecte spécifiquement BNP32 dans ELISA, IHC, DB et IHC (p). Il présente une réactivité envers Humain.

Aperçu rapide pour BNP32 anticorps (ABIN1100299)

Antigène: BNP32 (BNP 32) (Brain Natriuretic Peptide 32 (BNP 32))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BNP32 est non-conjugé

Application: ELISA, Immunohistochemistry (IHC), Dot Blot (DB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-BNP32 anticorps

Marque: IHC-plus™

Purification: Protein G purified

Immunogène: Synthetic peptide (Human BNP: NH2-CSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH) conjugated with KLH

Type of Immunogen: Synthetic peptide - KLH conjugated

Isotype: IgG

Information d'application

Indications d'application: Approved: DB, ELISA (1:40000), IHC, IHC-P (10 μg/mL)

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Reconstitute at 1 mg/mL in PBS

Concentration: Lot specific

Buffer: Lyophilized from PBS. No preservative added

Agent conservateur: Without preservative

Détails sur BNP32

Antigène: BNP32 (BNP 32) (Brain Natriuretic Peptide 32 (BNP 32))