IVNS1ABP anticorps (N-Term)

N° du produit ABIN1107889

Cet anticorps Lapin Polyclonal détecte spécifiquement IVNS1ABP dans WB et IHC (p). Il présente une réactivité envers Humain, Souris, Rat, Chien, Boeuf (Vache), Poisson zèbre (Danio rerio), Porc et Xenopus laevis.

Aperçu rapide pour IVNS1ABP anticorps (N-Term) (ABIN1107889)

Antigène: IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))

Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Poisson zèbre (Danio rerio), Porc, Xenopus laevis

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IVNS1ABP est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-IVNS1ABP anticorps

Épitope: N-Term

Séquence: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL

Réactivité croisée (Details): Species reactivity (expected):Mouse, Dog, Rat, African clawed frog, Bovine, Pig, ZebrafishSpecies reactivity (tested):Human

Purification: Purified using Protein A affinity column

Immunogène: The immunogen for anti-IVNS1ABP antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP.

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Reconstitution: Add 100 μL of distilled water to a final concentration of 1 mg/mL.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.

Détails sur IVNS1ABP

Antigène: IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))

Autre désignation: IVNS1ABP

Classe de substances: Influenza Protein

Sujet: This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.Synonyms: ARA3, Aryl hydrocarbon receptor-associated protein 3, FLARA3, HSPC068, Influenza virus NS1A-binding protein, KIAA0850, NS1, NS1-binding protein, NS1BP

ID gène: 10625

NCBI Accession: NP_006460

Pathways: Negative Regulation of intrinsic apoptotic Signaling