IVNS1ABP anticorps (N-Term)
-
- Antigène Voir toutes IVNS1ABP Anticorps
- IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien, Boeuf (Vache), Poisson zèbre (Danio rerio), Porc, Xenopus laevis
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IVNS1ABP est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Séquence
- MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL
- Réactivité croisée (Details)
- Species reactivity (expected):Mouse, Dog, Rat, African clawed frog, Bovine, Pig, ZebrafishSpecies reactivity (tested):Human
- Purification
- Purified using Protein A affinity column
- Immunogène
- The immunogen for anti-IVNS1ABP antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP.
- Top Product
- Discover our top product IVNS1ABP Anticorps primaire
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Reconstitution
- Add 100 μL of distilled water to a final concentration of 1 mg/mL.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.
-
- Antigène
- IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))
- Autre désignation
- IVNS1ABP (IVNS1ABP Produits)
- Synonymes
- anticorps 1190004M08Rik, anticorps 1700126I16Rik, anticorps AA960440, anticorps HSPC068, anticorps ND1, anticorps NS-1, anticorps NS1-BP, anticorps Nd1-L, anticorps Nd1-S, anticorps mKIAA0850, anticorps cb1052, anticorps fj23g11, anticorps ivns1abp, anticorps wu:fj23g11, anticorps FLARA3, anticorps KLHL39, anticorps NS1BP, anticorps fi13f08, anticorps fi41c09, anticorps wu:fi13f08, anticorps wu:fi41c09, anticorps influenza virus NS1A binding protein, anticorps influenza virus NS1A binding protein a, anticorps influenza virus NS1A binding protein L homeolog, anticorps influenza virus NS1A binding protein b, anticorps Ivns1abp, anticorps ivns1abpa, anticorps ivns1abp.L, anticorps IVNS1ABP, anticorps ivns1abpb
- Classe de substances
- Influenza Protein
- Sujet
- This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.Synonyms: ARA3, Aryl hydrocarbon receptor-associated protein 3, FLARA3, HSPC068, Influenza virus NS1A-binding protein, KIAA0850, NS1, NS1-binding protein, NS1BP
- ID gène
- 10625
- NCBI Accession
- NP_006460
- Pathways
- Negative Regulation of intrinsic apoptotic Signaling
-