SNF8 anticorps (N-Term)

N° du produit ABIN1109459

L’anticorps Lapin Polyclonal anti-SNF8 a été validé pour WB et IHC (p). Il convient pour détecter SNF8 dans des échantillons de Humain, Rat, Souris, Boeuf (Vache), Chien, Poisson zèbre (Danio rerio), Xenopus laevis et Poulet.

Aperçu rapide pour SNF8 anticorps (N-Term) (ABIN1109459)

Antigène: SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))

Reactivité: Humain, Rat, Souris, Boeuf (Vache), Chien, Poisson zèbre (Danio rerio), Xenopus laevis, Poulet

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNF8 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-SNF8 anticorps

Épitope: N-Term

Séquence: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF

Réactivité croisée (Details): Species reactivity (expected):Mouse, Rat, African clawed frog, Bovine, Dog, Chicken, ZebrafishSpecies reactivity (tested):Human

Purification: Purified on peptide immunoaffinity column

Immunogène: The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Reconstitution: Add 50 μL of distilled water

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: -20 °C

Stockage commentaire: Store the lyophised antibody at -20 °C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20 °C long term.

Date de péremption: 12 months

Détails sur SNF8

Antigène: SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))

Autre désignation: Vacuolar-Sorting Protein SNF8

Sujet: ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25, and VPS36 form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation facto.Synonyms: EAP30, ELL-associated protein of 30 kDa, ESCRT-II complex subunit VPS22

ID gène: 11267

NCBI Accession: NP_009172