ZNF76 anticorps (Middle Region)

N° du produit ABIN1109607

Cet anticorps anti-ZNF76 est un anticorps Lapin Polyclonal détectant ZNF76 dans WB. Adapté pour Humain, Souris, Rat, Chien, Boeuf (Vache) et Porc.

Aperçu rapide pour ZNF76 anticorps (Middle Region) (ABIN1109607)

Antigène: ZNF76 (Zinc Finger Protein 76 (Expressed in Testis) (ZNF76))

Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Porc

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZNF76 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ZNF76 anticorps

Épitope: Middle Region

Séquence: MHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKRPRIAYLSEVK

Réactivité croisée (Details): Species reactivity (expected):Mouse, Rat, Pig, Bovine, DogSpecies reactivity (tested):Human

Purification: Purified using peptide immunoaffinity column

Immunogène: The immunogen for anti-ZNF76 antibody: synthetic peptide directed towards the middle region of human ZNF76

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Reconstitution: Add 50 μL of distilled water to a final concentration of 1 mg/mL.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.

Détails sur ZNF76

Antigène: ZNF76 (Zinc Finger Protein 76 (Expressed in Testis) (ZNF76))

Autre désignation: ZNF76

Sujet: ZNF76 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers. ZNF76 may be involved in transcriptional regulation.Synonyms: D6S229E, ZNF523, Zinc finger protein 523, Zinc finger protein 76

ID gène: 7629

NCBI Accession: NP_003418