Ataxin 1 anticorps (AA 164-197)

N° du produit ABIN1304549

L’anticorps Souris Monoclonal anti-Ataxin 1 a été validé pour WB, IHC, ELISA, IP et ICC. Il convient pour détecter Ataxin 1 dans des échantillons de Souris.

Aperçu rapide pour Ataxin 1 anticorps (AA 164-197) (ABIN1304549)

Antigène: Ataxin 1 (ATXN1)

Reactivité: Souris

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Ataxin 1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), ELISA, Immunoprecipitation (IP), Immunocytochemistry (ICC)

Classe de qualité: KO Validated

Clone: N76-8

Détail du produit anti-Ataxin 1 anticorps

Épitope: AA 164-197

Fonction: Anti-Ataxin-1, 11NQ Antibody

Séquence: ATTPSQRSQL EAYSTLLANM GSLSQAPGHK VEPP

Specificité: No off-targets reported

Réactivité croisée: Humain, Rat

Attributs du produit: Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody is produced in-house from hybridoma clone N76/8. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by protein a chromatography. It is great for use in WB, IHC, ICC, IP, ELISA.

Purification: Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.

Pureté: Purified mAbs are >90 % specific antibody.

Immunogène: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254)

Isotype: IgG2b

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 1 mg/mL

Buffer: 10 mM Tris, 50 mM Sodium Chloride, 0.065 % Sodium Azide 7.4

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.

Date de péremption: 24 months

Détails sur Ataxin 1

Antigène: Ataxin 1 (ATXN1)

Autre désignation: Ataxin-1

Sujet:

Synonyms: Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog)

Description Logic: Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody is produced from hybridoma clone N76/8. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by protein a chromatography. It is great for use in WB, IHC, ICC, IP, ELISA.

Gene Name Alternatives: Atxn1 Sca1

Poids moléculaire: 85 kDa

UniProt: P54254

Pathways: Synaptic Membrane