ZNF93 anticorps

N° du produit ABIN1449891

Détail du produit anti-ZNF93 anticorps

Antigène: ZNF93 (Zinc Finger Protein 93 (ZNF93))

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Boeuf (Vache), Xenopus laevis

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZNF93 est non-conjugé

Application: Western Blotting (WB)

Réactivité croisée (Details): Species reactivity (tested):Human, Mouse, Rat, Zebrafish, African clawed frog, Bovine

Purification: Purified using peptide immunoaffinity column

Immunogène: A synthetic peptide located within the following region of human ZNF93: FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Reconstitution: Add 50 μL of distilled water to a final concentration of 1 mg/mL.

Concentration: 1.0 mg/mL after reconstitution

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.

Détails sur ZNF93

Antigène: ZNF93 (Zinc Finger Protein 93 (ZNF93))

Autre désignation: ZNF93 (ZNF93 Produits)

Synonymes: anticorps ZNF354A, anticorps MGC143044, anticorps HPF34, anticorps HTF34, anticorps TF34, anticorps ZNF505, anticorps Znf235, anticorps zinc finger protein 93, anticorps ZNF93, anticorps Zfp93

Sujet: ZNF93 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.Synonyms: HTF34, ZNF505, Zinc finger protein 505, Zinc finger protein 93, Zinc finger protein HTF34

Poids moléculaire: 71 kDa (620 aa)

ID gène: 81931

NCBI Accession: NP_112495