Ataxin 1 anticorps (AA 164-197) (HRP)

N° du produit ABIN1741210

Cet anticorps Souris Monoclonal détecte spécifiquement Ataxin 1 dans WB, IHC, IF, IP et ICC. Il présente une réactivité envers Souris.

Aperçu rapide pour Ataxin 1 anticorps (AA 164-197) (HRP) (ABIN1741210)

Antigène: Ataxin 1 (ATXN1)

Reactivité: Souris

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Ataxin 1 est conjugé à/à la HRP

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunoprecipitation (IP), Immunocytochemistry (ICC)

Clone: S76-8

Détail du produit anti-Ataxin 1 anticorps (HRP)

Épitope: AA 164-197

Specificité: Detects ~85 kDa.

Réactivité croisée: Humain, Souris, Rat

Purification: Protein G Purified

Immunogène: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).

Isotype: IgG2b

Information d'application

Indications d'application:

• WB (1:1000)
• ICC/IF (1:100)
• optimal dilutions for assays should be determined by the user.

Commentaires:

1 μg/ml of ABIN1741210 was sufficient for detection of Ataxin-1 in 20 μg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 1 mg/mL

Buffer: PBS pH 7.4, 50 % glycerol, 0.1 % sodium azide, Storage buffer may change when conjugated

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C

Stockage commentaire: Conjugated antibodies should be stored at 4°C

Détails sur Ataxin 1

Antigène: Ataxin 1 (ATXN1)

Autre désignation: Ataxin 1

Sujet: Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.

ID gène: 20238

NCBI Accession: NP_001186233

UniProt: P54254

Pathways: Synaptic Membrane