Complexin 1, 2 (AA 45-81) anticorps

N° du produit ABIN1742265

Détail du produit

Antigène: Complexin 1, 2

Épitope: AA 45-81

Reactivité: Souris, Rat, Humain, Boeuf (Vache), Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Immunocytochemistry (ICC), Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)

Specificité: Recognizes complexin 1 and 2.

Purification: antiserum

Immunogène: Synthetic peptide EEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAE (aa 45-81 in complexin 2) coupled to key-hole limpet hemocyanin via an added N-terminal cysteine residue. Immunogen is located inside the mapped binding domain of complexin 2 to the SNARE complex (aa 41 - 91).

Information d'application

Indications d'application: WB: 1 : 1000 up to 1 : 20000 (AP staining)
ICC: 1 : 200 up to 1 : 500

Commentaires:

IP: Co-immunoprecipitates the SNARE complex.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: PBS

Conseil sur la manipulation: Crude antisera are more robust than monoclonals. With anti-microbials added, they may be stored at 4 °C.
Serum does not contain active proteases, in fact, serum itself contains a powerful cocktail of protease inhibitors. Frozen storage (-20 °C),however, is preferable.

Stock: 4 °C/-20 °C

Stockage commentaire: Unlabeled antibodies are stable in this form without loss of quality at ambient temperatures for several weeks or even months. They can be stored at 4 °C for several years.

Référence

Getz, Visser, Bell, Xu, Flynn, Zaidi, Syed: "Two proteolytic fragments of menin coordinate the nuclear transcription and postsynaptic clustering of neurotransmitter receptors during synaptogenesis between Lymnaea neurons." dans: Scientific reports, Vol. 6, pp. 31779, (2016) (PubMed).

Wilhelm, Mandad, Truckenbrodt, Kröhnert, Schäfer, Rammner, Koo, Claßen, Krauss, Haucke, Urlaub, Rizzoli: "Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins." dans: Science (New York, N.Y.), Vol. 344, Issue 6187, pp. 1023-8, (2014) (PubMed).

Tsai, Brewis, van Maaren, Gadella: "Involvement of complexin 2 in docking, locking and unlocking of different SNARE complexes during sperm capacitation and induced acrosomal exocytosis." dans: PLoS ONE, Vol. 7, Issue 3, pp. e32603, (2012) (PubMed).

Lee, Brecha: "Immunocytochemical evidence for SNARE protein-dependent transmitter release from guinea pig horizontal cells." dans: The European journal of neuroscience, Vol. 31, Issue 8, pp. 1388-401, (2010) (PubMed).

Falkowski, Thomas, Groblewski: "Complexin 2 modulates vesicle-associated membrane protein (VAMP) 2-regulated zymogen granule exocytosis in pancreatic acini." dans: The Journal of biological chemistry, Vol. 285, Issue 46, pp. 35558-66, (2010) (PubMed).

Détail du antigène

Antigène: Complexin 1, 2

Sujet: Synonyms: Synaphin 2,1, CPX 1, CPX 2