NMS anticorps (AA 70-103)

N° du produit ABIN1831479

Cet anticorps anti-NMS est un anticorps Lapin Polyclonal détectant NMS dans ELISA. Adapté pour Souris.

Aperçu rapide pour NMS anticorps (AA 70-103) (ABIN1831479)

Antigène: NMS (Neuromedin S (NMS))

Reactivité: Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NMS est non-conjugé

Application: ELISA

Détail du produit anti-NMS anticorps

Épitope: AA 70-103

Specificité: Mouse Neuromedin S.

Purification: Protein A purified

Immunogène: Synthetic peptide corresponding to aa70-103 of mouse prepro-Neuromedin S (FLFHYSRTRKPTHPVSAEFAPVHPLMRLAAKLAS).

Type of Immunogen: Synthetic peptide

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Mouse

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: PBS

Concentration: Lot specific

Buffer: Lyophilized from PBS,  pH 7

Conseil sur la manipulation: Aliquot to avoid repeated freezing and thawing.

Stock: -20 °C

Stockage commentaire: Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C.

Détails sur NMS

Antigène: NMS (Neuromedin S (NMS))

Autre désignation: NMS

Sujet: Name/Gene ID: NMS

Synonyms: NMS, FLGRACILE, Neuromedin-S, Neuromedin S, PTD, BJS

ID gène: 129521

UniProt: Q5H8A3