NPPB anticorps (N-Term)

N° du produit ABIN191931

L’anticorps Souris Monoclonal anti-NPPB a été validé pour EIA. Il convient pour détecter NPPB dans des échantillons de Humain.

Aperçu rapide pour NPPB anticorps (N-Term) (ABIN191931)

Antigène: NPPB (Natriuretic Peptides B (NPPB))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp NPPB est non-conjugé

Application: Enzyme Immunoassay (EIA)

Clone: 01-03-21

Détail du produit anti-NPPB anticorps

Épitope: AA 1-32, N-Term

Specificité: This antibody detects synthetic BNP (aa 1-32) and recombinant proBNP (aa 1-108).

Purification: Protein G chromatography

Immunogène: Synthetic human BNP (aa 1-32) KLH conjugatedAA Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Isotype: IgG2b

Information d'application

Indications d'application: ELISA.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Restrictions: For Research Use only

Stockage

Reconstitution: Restore in aqua bidest to 1 mg/mL.

Buffer: PBS pH 7,4

Stock: 4 °C/-20 °C

Stockage commentaire: Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing.
Shelf life: One year from despatch.

Date de péremption: 12 months

Détails sur NPPB

Antigène: NPPB (Natriuretic Peptides B (NPPB))

Autre désignation: Natriuretic Peptides B

Sujet: In cardiac tissue brain natriuretic peptide (BNP) is synthesized as 134 amino acid precursor (prepro-BNP), which is cleaved by proteases to form a 26 aa "signal" peptide and a 108 aa pro-BNP. Proteolytic digestion of pro-BNP results in formation of 76 aa amino-terminal NT-proBNP and biologically active 32 aa BNP hormone molecule. Both proBNP and NTproBNP circulate in human plasma and have been proposed as markers for early diagnosis of left ventricular dysfunction as well as prognostic markers of possible cardiac complications at patients with heart failure.

ID gène: 4879

UniProt: P16860

Pathways: Hormone Activity