beta 2 Defensin anticorps (AA 4-41)

N° du produit ABIN191997

L’anticorps Souris Monoclonal anti-beta 2 Defensin a été validé pour WB, IHC (p) et EIA. Il convient pour détecter beta 2 Defensin dans des échantillons de Humain. Il y a 1 publication disponible.

Aperçu rapide pour beta 2 Defensin anticorps (AA 4-41) (ABIN191997)

Antigène: beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp beta 2 Defensin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Enzyme Immunoassay (EIA)

Clone: L12-4C-C2

Détail du produit anti-beta 2 Defensin anticorps

Épitope: AA 4-41

Specificité: This antibody recognizes Human beta-Defensin 2 (aa 4-41).

Attributs du produit: Synonyms: Beta-defensin 4A, Beta-defensin 2, BD-2, hBD-2, DEFB102, DEFB2, Skin-antimicrobialpeptide 1, DEFB4B, DEFB4A

Purification: Protein G Chromatography

Immunogène: Synthetic peptide corresponding to amino acids 4-41 of Human beta-Defensin 2. AA Sequence: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Isotype: IgG1

Information d'application

Indications d'application: ELISA.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Restrictions: For Research Use only

Stockage

Reconstitution: Restore in 0.1 mL aqua bidest to 1 mg/mL.

Buffer: 50 mM TRIS pH 7.4

Stock: 4 °C/-20 °C

Stockage commentaire: Store lyophilized at 2-8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing.
Shelf life: One year from despatch.

Date de péremption: 12 months

Références pour anticorps anti-beta 2 Defensin (ABIN191997)

Desmet, Van Gele, Grine, Remaut, Lambert: "Towards the development of a RNAi-based topical treatment for psoriasis: Proof-of-concept in a 3D psoriasis skin model." dans: Experimental dermatology, (2018) (PubMed).

Détails sur beta 2 Defensin

Antigène: beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))

Autre désignation: Defensin beta 2

Sujet: This antibiotic peptide is locally regulated by inflammation. Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence.Synonyms: BD-2, Beta-defensin 2, Beta-defensin 4A, DEFB102, DEFB2, DEFB4A, DEFB4B, Skin-antimicrobial peptide 1, hBD-2

ID gène: 100289462

UniProt: O15263