beta Defensin 1 anticorps (N-Term)

N° du produit ABIN192005

Cet anticorps Souris Monoclonal détecte spécifiquement beta Defensin 1 dans WB et EIA. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour beta Defensin 1 anticorps (N-Term) (ABIN192005)

Antigène: beta Defensin 1 (DEFB1) (Defensin, beta 1 (DEFB1))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp beta Defensin 1 est non-conjugé

Application: Western Blotting (WB), Enzyme Immunoassay (EIA)

Clone: M4-14b-H4 (M11-14b-H4)

Détail du produit anti-beta Defensin 1 anticorps

Épitope: AA 1-36, N-Term

Specificité: This antibody detects Beta-Defensin 1 (aa 1-36). No cross reactivity obtainded with Human Beta-Defensin 3, Beta-Defensin 4, Beta-Defensin 12 and Beta-Defensin 16.

Attributs du produit: Synonyms: Beta-defensin 1, BD1, BD-1, HBD1, hBD-1, DEFB1, DEFB101

Purification: Protein G Chromatography

Immunogène: Synthetic human β-Defensin 1 (aa 1-36) (3 disulfide bridges)AA Sequence: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Isotype: IgG1

Information d'application

Indications d'application: ELISA. Western blot.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Restrictions: For Research Use only

Stockage

Reconstitution: Restore in aqua bidest to 1 mg/mL.

Buffer: PBS, pH 7.4

Stock: 4 °C/-20 °C

Stockage commentaire: Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing and thawing.
Shelf life: One year from despatch.

Date de péremption: 12 months

Détails sur beta Defensin 1

Antigène: beta Defensin 1 (DEFB1) (Defensin, beta 1 (DEFB1))

Autre désignation: Defensin beta 1

Sujet: Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. The mature form of Beta defensin 1 is 36 amino acids.Synonyms: BD-1, BD1, Beta-defensin 1, DEFB1, DEFB101, HBD1, hBD-1

ID gène: 1672

UniProt: P60022