Ataxin 1 anticorps (AA 164-197)

N° du produit ABIN1976879

L’anticorps Souris Monoclonal anti-Ataxin 1 a été validé pour WB, IHC et IP. Il convient pour détecter Ataxin 1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour Ataxin 1 anticorps (AA 164-197) (ABIN1976879)

Antigène: Ataxin 1 (ATXN1)

Reactivité: Humain, Souris, Rat

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Ataxin 1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)

Clone: S76-8

Détail du produit anti-Ataxin 1 anticorps

Épitope: AA 164-197

Specificité: Detects a 85 kD protein.

Purification: Protein G purified from tissue culture supernatant

Immunogène: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 (Accession No. P54254). Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). Percent identity by BLAST analysis: Mouse, Rat (100%).

Type of Immunogen: Synthetic peptide

Isotype: IgG2b

Information d'application

Indications d'application: Approved: IHC, IP, WB (1:1000)

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: PBS,  pH 7.4, 0.1 % sodium azide, 50 % glycerol.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: -20 °C

Stockage commentaire: Store at -20°C.

Détails sur Ataxin 1

Antigène: Ataxin 1 (ATXN1)

Autre désignation: ATXN1 / Ataxin-1 / SCA1

Sujet: Name/Gene ID: ATXN1

Synonyms: ATXN1, ATX1, Ataxin 1, D6S504E, Ataxin-1, SCA1

ID gène: 6310

Pathways: Synaptic Membrane