beta 2 Defensin anticorps (AA 4-41)

N° du produit ABIN234970

Cet anticorps Souris Monoclonal détecte spécifiquement beta 2 Defensin dans ELISA. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour beta 2 Defensin anticorps (AA 4-41) (ABIN234970)

Antigène: beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp beta 2 Defensin est non-conjugé

Application: ELISA

Clone: L12-4C-C2

Détail du produit anti-beta 2 Defensin anticorps

Épitope: AA 4-41

Specificité: Synthetic human beta-Defensin 2 (AA 4-41)

Attributs du produit: MAb to beta-Defensin-2 (AA 4-41), Monoclonal antibody to Human beta-Defensin-2 (AA 4-41), Cell culture supernatant

Purification: Protein L. Cell culture

Immunogène: Synthetic human beta-Defensin 2 (AA 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)

Isotype: IgG1

Information d'application

Indications d'application: Suitable for use in ELISA. Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Reconstitute in 10 µL double distilled water.

Buffer: Lyophilized from 50 mM Tris, pH 7.4.

Agent conservateur: Without preservative

Conseil sur la manipulation: Avoid multiple freeze/thaw cycles.
Centrifuge product if not completely clear after standing at room temperature.
Prepare working dilution only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store lyophilized product at 2-8 °C. After reconstitution, store at -28 °C.

Détails sur beta 2 Defensin

Antigène: beta 2 Defensin (BD-2) (Defensin beta 2 (BD-2))

Autre désignation: Beta-Defensin-2