ABCC9 anticorps (AA 1505-1546) (FITC)

N° du produit ABIN2482979

Cet anticorps anti-ABCC9 Monoclonal Souris conjugué à FITC (Clone S319A-14) (ABIN2482979) détecte spécifiquement ABCC9 dans WB, IHC, ICC et IF. L’anticorps est réactif avec des échantillons de Souris.

Aperçu rapide pour ABCC9 anticorps (AA 1505-1546) (FITC) (ABIN2482979)

Antigène: ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))

Reactivité: Souris

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp ABCC9 est conjugé à/à la FITC

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF)

Clone: S319A-14

Détail du produit anti-ABCC9 anticorps (FITC)

Épitope: AA 1505-1546

Specificité: Detects ~120 kDa. Does not cross-react with SUR2B.

Réactivité croisée: Humain, Souris, Rat

Purification: Protein G Purified

Immunogène: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A

Isotype: IgG2a

Information d'application

Indications d'application:

• WB (1:1000)
• optimal dilutions for assays should be determined by the user.

Commentaires:

1 μg/ml of ABIN2482979 was sufficient for detection of SUR2A in 20 μg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 1 mg/mL

Buffer: PBS pH 7.4, 50 % glycerol, 0.1 % sodium azide, Storage buffer may change when conjugated

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C

Stockage commentaire: Conjugated antibodies should be stored at 4°C

Détails sur ABCC9

Antigène: ABCC9 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 9 (ABCC9))

Autre désignation: SUR2A

Sujet: Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).

ID gène: 20928

NCBI Accession: NP_001038185

UniProt: P70170