POMC anticorps (AA 138-176)

N° du produit ABIN2614195

Cet anticorps anti-POMC est un anticorps Lapin Polyclonal détectant POMC dans IHC et IHC (p). Adapté pour Humain et Singe.

Aperçu rapide pour POMC anticorps (AA 138-176) (ABIN2614195)

Antigène: POMC (Proopiomelanocortin (POMC))

Reactivité: Humain, Singe

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POMC est non-conjugé

Application: Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-POMC anticorps

Épitope: AA 138-176

Specificité: ACTH and MSH are produced by the pituitary gland.

Réactivité croisée (Details): No cross reactivity with other proteins.

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human ACTH(138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2 HPO4, 0.05 mg sodium azide per 100 μg antibody.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur POMC

Antigène: POMC (Proopiomelanocortin (POMC))

Autre désignation: POMC / Proopiomelanocortin

Sujet: Name/Gene ID: POMC
Family: Hormone

Synonyms: POMC, Alpha-MSH, ACTH, Adrenocorticotropin, Adrenocorticotropic hormone, Beta-LPH, CLIP, Gamma-MSH, Lipotropin gamma, LPH, Melanotropin alpha, Met-enkephalin, Melanotropin beta, NPP, Pro-ACTH-endorphin, Lipotropin beta, Melanotropin gamma, MSH, Proopiomelanocortin, Beta-endorphin, Beta-MSH, Corticotropin-lipotropin, Gamma-LPH, POC, Pro-opiomelanocortin

ID gène: 5443

Pathways: Metabolism of Steroid Hormones and Vitamin D, Peptide Hormone Metabolism, Hormone Activity, Feeding Behaviour