RUNX1 anticorps (AA 200-233)

N° du produit ABIN2616047

Cet anticorps Lapin Polyclonal détecte spécifiquement RUNX1 dans WB, IHC et IHC (p). Il présente une réactivité avec des échantillons de Humain, Souris, Rat, Boeuf (Vache), Cheval, Singe, Chimpanzé, Hamster et Orang-Utan.

Aperçu rapide pour RUNX1 anticorps (AA 200-233) (ABIN2616047)

Antigène: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Reactivité: Humain, Souris, Rat, Boeuf (Vache), Cheval, Singe, Chimpanzé, Hamster, Orang-Utan

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RUNX1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-RUNX1 anticorps

Épitope: AA 200-233

Specificité: Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood.

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human RUNX1(200-233aa ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2 HPO4, 0.05 mg Thimerosal, 0.05 mg sodium azide per 100 μg antibody.

Agent conservateur: Sodium azide, Thimerosal (Merthiolate)

Précaution d'utilisation: This product contains Sodium azide and Thimerosal (Merthiolate): POISONOUS AND HAZARDOUS SUBSTANCES which should be handled by trained staff only.

Conseil sur la manipulation: Avoid freeze-thaw cycles.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur RUNX1

Antigène: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Autre désignation: AML1 / RUNX1

Sujet: Name/Gene ID: RUNX1

Synonyms: RUNX1, AMLCR1, Aml1 oncogene, AML1, AML1-EVI-1, CBF-alpha-2, CBFA2, Acute myeloid leukemia 1, EVI-1, PEBP2A2, PEA2-alpha B, AML1-EVI-1 fusion protein, Oncogene AML-1, PEBP2-alpha B, PEBP2aB

ID gène: 861