RUNX1 anticorps (AA 200-233)

N° du produit ABIN2616047

Détail du produit anti-RUNX1 anticorps

Antigène: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Épitope: AA 200-233

Reactivité: Humain, Souris, Rat, Boeuf (Vache), Cheval, Singe, Chimpanzé, Hamster, Orang-Utan

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RUNX1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Specificité: Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood.

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human RUNX1(200-233aa ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2 HPO4, 0.05 mg Thimerosal, 0.05 mg sodium azide per 100 μg antibody.

Agent conservateur: Sodium azide, Thimerosal (Merthiolate)

Précaution d'utilisation: This product contains Sodium azide and Thimerosal (Merthiolate): POISONOUS AND HAZARDOUS SUBSTANCES which should be handled by trained staff only.

Conseil sur la manipulation: Avoid freeze-thaw cycles.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur RUNX1

Antigène: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Autre désignation: AML1 / RUNX1 (RUNX1 Produits)

Synonymes: anticorps RUNX1, anticorps runx1, anticorps AI462102, anticorps AML1, anticorps Cbfa2, anticorps Pebp2a2, anticorps Pebpa2b, anticorps AML1-EVI-1, anticorps AMLCR1, anticorps CBFA2, anticorps EVI-1, anticorps PEBP2aB, anticorps runxa, anticorps Runx-1, anticorps XAML, anticorps Xaml1, anticorps aml, anticorps aml-1, anticorps aml1, anticorps aml1-evi-1, anticorps amlcr1, anticorps cbfa2, anticorps evi-1, anticorps pebp2ab, anticorps Aml1, anticorps uncharacterized LOC473981, anticorps runt-related transcription factor, anticorps runt related transcription factor 1, anticorps runt-related transcription factor 1, anticorps runt related transcription factor 1 L homeolog, anticorps LOC473981, anticorps runt, anticorps Runx1, anticorps RUNX1, anticorps runx1, anticorps runx1.L

Sujet: Name/Gene ID: RUNX1

Synonyms: RUNX1, AMLCR1, Aml1 oncogene, AML1, AML1-EVI-1, CBF-alpha-2, CBFA2, Acute myeloid leukemia 1, EVI-1, PEBP2A2, PEA2-alpha B, AML1-EVI-1 fusion protein, Oncogene AML-1, PEBP2-alpha B, PEBP2aB

ID gène: 861