HKDC1 anticorps (AA 102-136)

N° du produit ABIN2741387

Détail du produit anti-HKDC1 anticorps

Antigène: HKDC1 (Hexokinase Domain Containing 1 (HKDC1))

Épitope: AA 102-136

Reactivité: Humain, Chimpanzé, Orang-Utan

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HKDC1 est non-conjugé

Application: Western Blotting (WB)

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human HKDC1(102-136aa KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD), different from the related mouse sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: avoid freeze thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur HKDC1

Antigène: HKDC1 (Hexokinase Domain Containing 1 (HKDC1))

Autre désignation: HKDC1 (HKDC1 Produits)

Synonymes: anticorps cb370, anticorps sb:cb370, anticorps HKDC1, anticorps BC016235, anticorps hexokinase domain containing 1, anticorps putative hexokinase HKDC1, anticorps hkdc1, anticorps HKDC1, anticorps LOC100088018, anticorps Hkdc1

Sujet: Name/Gene ID: HKDC1

Synonyms: HKDC1, Putative hexokinase HKDC1, Hexokinase domain containing 1

ID gène: 80201