MMP3 anticorps (AA 410-439)

N° du produit ABIN2742989

Détail du produit anti-MMP3 anticorps

Antigène: MMP3 (Matrix Metallopeptidase 3 (Stromelysin 1, Progelatinase) (MMP3))

Épitope: AA 410-439

Reactivité: Humain, Gibbon

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP3 est non-conjugé

Application: Western Blotting (WB)

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3(410-439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA), different from the related mouse sequence by seven amino acids, and from the related mouse sequence by ten amino acids.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: avoid freeze thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur MMP3

Antigène: MMP3 (Matrix Metallopeptidase 3 (Stromelysin 1, Progelatinase) (MMP3))

Autre désignation: MMP3 (MMP3 Produits)

Synonymes: anticorps CHDS6, anticorps MMP-3, anticorps SL-1, anticorps STMY, anticorps STMY1, anticorps STR1, anticorps SLN-1, anticorps SLN1, anticorps STR-1, anticorps Stmy1, anticorps Str1, anticorps MMP10, anticorps chds6, anticorps mmp-3, anticorps mmp13, anticorps mmp3, anticorps sl-1, anticorps stmy, anticorps stmy1, anticorps str1, anticorps matrix metallopeptidase 3, anticorps matrix metallopeptidase 3 (stromelysin 1, progelatinase), anticorps matrix metallopeptidase 3 L homeolog, anticorps MMP3, anticorps Mmp3, anticorps mmp3.L

Sujet: Name/Gene ID: MMP3
Subfamily: Metallopeptidase M10A
Family: Protease

Synonyms: MMP3, CHDS6, MMP-3, Prostromelysin-1, Proteoglycanase, SL-1, STR1, Matrix metalloproteinase-3, Transin, Transin-1, SLN-1, STMY, Progelatinase, STMY1, Stromelysin-1

ID gène: 4314