NPY anticorps (AA 29-64)

N° du produit ABIN2743210

Cet anticorps Lapin Polyclonal détecte spécifiquement NPY dans WB, IHC et IHC (p). Il présente une réactivité envers Humain, Rat, Souris, Lapin, Chien, Cobaye, Hamster, Singe et Chimpanzé.

Aperçu rapide pour NPY anticorps (AA 29-64) (ABIN2743210)

Antigène: NPY (Neuropeptide Y (NPY))

Reactivité: Humain, Rat, Souris, Lapin, Chien, Cobaye, Hamster, Singe, Chimpanzé

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NPY est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-NPY anticorps

Épitope: AA 29-64

Specificité: One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: avoid freeze thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur NPY

Antigène: NPY (Neuropeptide Y (NPY))

Autre désignation: Neuropeptide Y / NPY

Sujet: Name/Gene ID: NPY
Family: Pancreatic hormone

Synonyms: NPY, Pro-neuropeptide Y, Neuropeptide Y, PYY4

ID gène: 4852

Pathways: Feeding Behaviour