OTX2 anticorps (AA 258-289)

N° du produit ABIN2743418

L’anticorps Lapin Polyclonal anti-OTX2 a été validé pour WB. Il convient pour détecter OTX2 dans des échantillons de Humain, Rat, Souris, Chien, Mouton, Lapin, Cheval, Boeuf (Vache), Roussette (Chauve-souris), Hamster, Porc, Xenopus laevis, Poulet, Chimpanzé, Gibbon, Singe et Orang-Utan.

Aperçu rapide pour OTX2 anticorps (AA 258-289) (ABIN2743418)

Antigène: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Reactivité: Humain, Rat, Souris, Chien, Mouton, Lapin, Cheval, Boeuf (Vache), Roussette (Chauve-souris), Hamster, Porc, Xenopus laevis, Poulet, Chimpanzé, Gibbon, Singe, Orang-Utan

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OTX2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-OTX2 anticorps

Épitope: AA 258-289

Specificité: Expressed in brain.

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: avoid freeze thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur OTX2

Antigène: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Autre désignation: OTX2

Sujet: Name/Gene ID: OTX2

Synonyms: OTX2, CPHD6, Homeobox protein OTX2, MCOPS5, Orthodenticle homeobox 2, Orthodenticle homolog 2

ID gène: 5015

Pathways: Dopaminergic Neurogenesis