PIM1 anticorps (AA 373-404)

N° du produit ABIN2743635

Cet anticorps anti-PIM1 est un anticorps Lapin Polyclonal détectant PIM1 dans WB. Adapté pour Humain, Cheval, Mouton, Singe, Chimpanzé et Gibbon.

Aperçu rapide pour PIM1 anticorps (AA 373-404) (ABIN2743635)

Antigène: PIM1 (Pim-1 Oncogene (PIM1))

Reactivité: Humain, Cheval, Mouton, Singe, Chimpanzé, Gibbon

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIM1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PIM1 anticorps

Épitope: AA 373-404

Specificité: Expressed primarily in cells of the hematopoietic and germline lineages. Isoform 1 and isoform 2 are both expressed in prostate cancer cell lines. .

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human PIM1(373-404aa EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK), different from the related mouse sequence by seven amino acids and from the related rat sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: avoid freeze thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur PIM1

Antigène: PIM1 (Pim-1 Oncogene (PIM1))

Autre désignation: PIM1 / Pim-1

Sujet: Name/Gene ID: PIM1
Subfamily: PIM
Family: Protein Kinase

Synonyms: PIM1, Pim-1 kinase 44 kDa isoform, Proviral integration site 1, Oncogene PIM1, PIM, Pim-1, Pim-1 oncogene

ID gène: 5292

Pathways: Glycosaminoglycan Metabolic Process