Peroxiredoxin 4 anticorps (AA 178-2081)

N° du produit ABIN2743788

Cet anticorps anti-Peroxiredoxin 4 est un anticorps Lapin Polyclonal détectant Peroxiredoxin 4 dans WB, IHC, ICC et IHC (p). Adapté pour Humain, Souris, Rat, Cheval, Singe et Orang-Utan.

Aperçu rapide pour Peroxiredoxin 4 anticorps (AA 178-2081) (ABIN2743788)

Antigène: Peroxiredoxin 4 (PRDX4)

Reactivité: Humain, Souris, Rat, Cheval, Singe, Orang-Utan

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Peroxiredoxin 4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-Peroxiredoxin 4 anticorps

Épitope: AA 178-2081

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Peroxiredoxin 4 (178-2081aa SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: avoid freeze thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur Peroxiredoxin 4

Antigène: Peroxiredoxin 4 (PRDX4)

Autre désignation: PRDX4 / Peroxiredoxin 4

Sujet: Name/Gene ID: PRDX4

Synonyms: PRDX4, Antioxidant enzyme AOE372, AOE37-2, Peroxiredoxin IV, Prx-IV, Thioredoxin peroxidase AO372, Peroxiredoxin-4, PRX-4, Peroxiredoxin 4

ID gène: 10549